KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125556Help
Entry
101125556         CDS       T02442                                 

Gene name
KAT2A
Definition
histone acetyltransferase KAT2A
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101125556 (KAT2A)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101125556 (KAT2A)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101125556 (KAT2A)
  Infectious diseases
   05166 HTLV-I infection
    101125556 (KAT2A)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101125556 (KAT2A)
Transcription machinery [BR:ggo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101125556 (KAT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 837 aa AA seqDB search
MAEPSQAPTPAPAAQPRPLQSPAPAPTPTPAPSPASAPIPTPTPAPAPAPAAAPASSTGT
GGPGVGSGGAGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKC
NGWKNPKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVE
NLFMSVHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQ
YKFSHLAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQAEDVATYKVNYTRWLCYCH
VPQSCDSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFL
SMLEEEIYGANSPIWESGFTMPPSEGTQLVPRPASVSAAVVPSTPIFSPSMGGGSNSSLS
LDSAGAEPMPGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLL
SANAARDETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIA
RLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKE
YHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIP
YTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLG
KEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTE
RLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccgaccccggccccggctgcgcagccccggccccttcag
tccccagcccctgccccaactccgactcctgcacccagcccggcttcagccccgattccg
actcccaccccggcaccagcccctgccccagctgcagccccagccagcagcacagggact
ggggggcccggggtaggaagtgggggggccgggagcgggggggatccggctcgacctggc
ctgagccagcagcagcgcgccagtcagaggaaggcgcaagtccgggggctgccgcgcgcc
aagaagcttgagaagctaggggtcttctcggcttgcaaggccaatgaaacctgtaagtgt
aatggctggaaaaaccccaagccccccactgcaccccgcatggatctgcagcagccagct
gccaacctgagtgagctgtgccgcagttgtgagcaccccttggctgaccacgtatcccac
ttggagaatgtgtcagaggatgagataaaccgactgctggggatggtggtggatgtggag
aatctcttcatgtctgttcacaaggaagaggacacagacaccaagcaggtctatttctac
ctcttcaagctactgcggaaatgcatcctgcagatgacccggcccgtggtggaggggtcc
ctgggcagccctccatttgagaaacctaatattgagcagggtgtgctgaactttgtgcag
tacaagtttagtcacctggctccccgggagcggcagacgatgttcgagctctcaaagatg
ttcttgctctgccttaactactggaagcttgagacacctgcccagtttcggcagaggtct
caggctgaggacgtggctacctacaaggtcaattataccagatggctctgttactgccac
gtgccccagagctgtgatagcctcccccgctacgaaaccactcatgtctttgggcgaagc
cttctccggtccattttcaccgttacccgccggcagctgctggaaaagttccgagtggag
aaggacaaattggtgcccgagaagaggaccctcatcctcactcacttccccaaattcctg
tccatgctggaggaggagatctatggggcaaactctccaatctgggagtcaggcttcacc
atgccaccctcagaggggacacagctggttccccggccagcttcagtcagtgcagcggtt
gttcccagcacccccatcttcagccccagcatgggtgggggcagcaacagctccctgagt
ctggattctgcaggggccgagcctatgccaggcgagaagaggaagctcccggagaacctg
accctggaggatgccaagcggctccgtgtgatgggtgacatccccatggagctggtcaat
gaggtcatgctgaccatcactgaccctgctgccatgctggggcctgagacgagcctgctt
tcggccaatgcggcccgggatgagacagcccgcctggaggagcgccgcggcatcatcgag
ttccatgtcatcggcaactcgctgacgcccaaggccaaccggcgggtgttgctgtggctc
gtcgggctgcagaatgtcttttcccaccagctgccgcgcatgcctaaggagtatatcgcc
cgcctcgtctttgacccgaagcacaagactctggccttgatcaaggatgggcgggtcatc
ggtggcatctgcttccgcatgtttcccacccagggcttcacggagattgtcttctgtgct
gtcacctcgaatgagcaggtcaagggttatgggacccacctgatgaaccacctgaaggag
tatcacatcaagcacaacattctctacttcctcacctacgccgacgagtatgccatcggc
tacttcaaaaagcagggtttctccaaggacatcaaggtgcccaagagccgctacctgggc
tacatcaaggactacgagggagcgacgctgatggagtgtgagctgaatccccgcatcccc
tacacggagctgtcccacatcatcaagaagcagaaagagatcatcaagaagctgattgag
cgcaaacaggcccagatccgcaaggtctacccggggctcagctgcttcaaggagggcgtg
aggcagatccctgtggagagcgttcctggcattcgagagacgggctggaagccattgggg
aaggagaaggggaaggagctgaaggaccccgaccagctctacacaaccctcaaaaacctg
ctggcccaaatcaagtctcaccccagtgcctggcccttcatggagcctgtgaagaagtcg
gaggcccctgactactacgaggtcatccgcttccccattgacctgaagaccatgactgag
cggctgcgaagccgctactacgtgacccggaagctctttgtggccgacctgcagcgggtc
atcgccaactgtcgcgagtacaaccccccggacagcgagtactgccgctgtgccagcgcc
ctggagaagttcttctacttcaagctcaaggagggagggctcattgacaagtag

DBGET integrated database retrieval system