KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125978Help
Entry
101125978         CDS       T02442                                 

Gene name
ABO
Definition
histo-blood group ABO system transferase
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Class
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - lacto and neolacto series [PATH:ggo00601]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 658 aa AA seqDB search
MPPAFTEMRTVPQEGGTGSGSCERGISVNSSERYQEKQEEASGTLREVTPLRSGARSPQS
LQPPPPPSPELPRADARAPWGREPGPGKRLCLGRRRGRGAQGPAGLEGYRLRRARAGRPG
IVGSGAAASRVRLPRLPGVAGCQGVTPAQETRCQGAPGGGASGAPGAARPQGGMRGQGPK
VPRLRGARGSHGDAREEAPSLPSRGPWGPAAASRALCPLPSGGQVGSAALWVPGTRGEDG
RGGAAWRGARLRGPWVLHLPPDPGRGQGSGLPCPPPSPSLGHGGQAPGLTGNSLHTPNAE
APREGEVGKFNAKRKPKCYTPLPMILFLIMLVLVLFGYGVLSPRSLMPGSLERGFCMAVT
EPDRLQRVSLPRMVYAQPKVLTPCRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTI
GLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQLSVLEVR
AYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLFGTLHPSF
YGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQRLTRACHQAMMVDQANGI
EAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPTVLRKLRFTAVPKNHQAVRNP
NT seq 1977 nt NT seq  +upstreamnt  +downstreamnt
atgcccccagctttcacggagatgagaacggtgccccaggagggcgggacgggatcaggg
tcctgtgaacggggtatcagtgtaaactcctctgagagataccaggaaaagcaggaagaa
gcctctgggacccttcgggaggtaactcctcttcgcagcggggcgcgctctccccagtcc
ctgcagccgccgccgccgccctctcctgagcttcctcgagcggacgccagagctccgtgg
ggccgcgagccggggccggggaagcgactctgcctagggagacgtcgcgggcgcggggca
cagggtcctgcggggctggagggctacaggctgcggcgcgcgcgagccggaaggccgggg
atcgtgggttctggggccgcagcttcacgggttcgtctcccccgcctccccggggtagca
ggatgtcagggggtcacccccgcccaggagacacggtgtcaaggtgcccccgggggcggg
gcttcaggggcacccggagccgctcggccccagggcgggatgcggggacagggccccaag
gtaccaaggctacgaggggcgcgcgggtcccatggggacgcgcgcgaggaggcgccgtcc
cttcctagcaggggtccctggggacccgcggccgcctcccgcgccctctgtcccctcccg
tccggcgggcaggtgggctcggccgcgctgtgggtgcctgggacccgcggggaggatggg
cgcggtggcgcggcctggcggggggctcgtctccggggtccctgggtcctgcacctaccg
cccgaccctggacgaggacaaggctccgggctgccctgcccgcctcccagcccttccctc
gggcacggcggccaggcgcccgggttgaccgggaacagcctccataccccaaacgcggag
gcgcctcgggaaggcgaggtgggcaagttcaatgccaagcgaaaaccaaaatgctacaca
cctctacctatgatccttttcctaataatgcttgtcttggtcttgtttggttacggggtc
ctaagccccagaagtctaatgccaggaagcctggaacgggggttctgcatggctgttacg
gaacctgaccgtctgcagcgcgtctcgttgccaaggatggtctacgcccagccaaaggtg
ctgacaccgtgtaggaaggatgtcctcgtggtgaccccttggctggctcccattgtctgg
gagggcacgttcaacatcgacatcctcaacgagcagttcaggctccagaacaccaccatt
gggttaactgtgtttgccatcaaaaaatacgtggctttcctgaagctgttcctggagacg
gcggagaagcacttcatggtgggccaccgtgtccactactatgtcttcaccgaccagccg
gccgcggtgccccgcgtgacgctggggaccggtcggcagctgtcggtgctggaggtgcgc
gcctacaagcgctggcaggacgtgtccatgcgccgcatggagatgatcagtgacttctgc
gagcggcgcttcctcagcgaggtggattacctggtgtgcgtggacgtggacatggagttc
cgcgaccacgtgggcgtggagatcctgactccgctgttcggcaccctgcaccccagcttc
tacggaagcagccgggaggccttcacctacgagcgccggccccagtcccaggcctacatc
cccaaggacgagggcgatttctactacatgggggcgttcttcggggggtcggtgcaagag
gtgcagcggctcaccagggcctgccaccaggccatgatggtcgaccaggccaacggcatc
gaggccgtgtggcacgacgagagccacctgaacaagtacctgctgcgccacaaacccacc
aaggtgctctcccccgagtacttgtgggaccagcagctgctgggctggcccaccgtcctg
aggaagctgaggttcactgcggtgcccaagaaccaccaggcggtccggaacccgtga

DBGET integrated database retrieval system