KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125978Help
Entry
101125978         CDS       T02442                                 

Gene name
ABO
Definition
(RefSeq) ABO, alpha 1-3-N-acetylgalactosaminyltransferase and alpha 1-3-galactosyltransferase
  KO
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    101125978 (ABO)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     101125978 (ABO)
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     101125978 (ABO)
Glycosyltransferases [BR:ggo01003]
 Glycan extension
  ABO blood group
   101125978 (ABO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
9
AA seq 377 aa AA seqDB search
MILFLIMLVLVLFGPCSFTGNSCAHAAGRTMHFLEEGTNRQSSFCVLSLGTLPSCSYGVL
SPRSLMPGSLERGFCMAVTEPDRLQRVSLPRMVYAQPKVLTPCRKDVLVVTPWLAPIVWE
GTFNIDILNEQFRLQNTTIGLTVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPA
AVPRVTLGTGRQLSVLEVRAYKRWQDVSMRRMEMISDFCERRFLSEVDYLVCVDVDMEFR
DHVGVEILTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEV
QRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQLLGWPTVLR
KLRFTAVPKNHQAVRNP
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatccttttcctaataatgcttgtcttggtcttgtttgggccttgcagcttcaccggg
aactcttgtgctcacgctgctggccgcaccatgcactttttggaggaagggaccaacagg
cagtcttcgttctgtgtcctgagtcttggcacacttccttcctgcagttacggggtccta
agccccagaagtctaatgccaggaagcctggaacgggggttctgcatggctgttacggaa
cctgaccgtctgcagcgcgtctcgttgccaaggatggtctacgcccagccaaaggtgctg
acaccgtgtaggaaggatgtcctcgtggtgaccccttggctggctcccattgtctgggag
ggcacgttcaacatcgacatcctcaacgagcagttcaggctccagaacaccaccattggg
ttaactgtgtttgccatcaaaaaatacgtggctttcctgaagctgttcctggagacggcg
gagaagcacttcatggtgggccaccgtgtccactactatgtcttcaccgaccagccggcc
gcggtgccccgcgtgacgctggggaccggtcggcagctgtcggtgctggaggtgcgcgcc
tacaagcgctggcaggacgtgtccatgcgccgcatggagatgatcagtgacttctgcgag
cggcgcttcctcagcgaggtggattacctggtgtgcgtggacgtggacatggagttccgc
gaccacgtgggcgtggagatcctgactccgctgttcggcaccctgcaccccagcttctac
ggaagcagccgggaggccttcacctacgagcgccggccccagtcccaggcctacatcccc
aaggacgagggcgatttctactacatgggggcgttcttcggggggtcggtgcaagaggtg
cagcggctcaccagggcctgccaccaggccatgatggtcgaccaggccaacggcatcgag
gccgtgtggcacgacgagagccacctgaacaagtacctgctgcgccacaaacccaccaag
gtgctctcccccgagtacttgtgggaccagcagctgctgggctggcccaccgtcctgagg
aagctgaggttcactgcggtgcccaagaaccaccaggcggtccggaacccgtga

DBGET integrated database retrieval system