KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126515Help
Entry
101126515         CDS       T02442                                 

Gene name
EZH1
Definition
(RefSeq) enhancer of zeste 1 polycomb repressive complex 2 subunit
  KO
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101126515 (EZH1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101126515 (EZH1)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101126515 (EZH1)
   Polycomb group proteins
    PRC2-EZH1 complex
     101126515 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
ENSGGOG00000003375
Position
5
AA seq 747 aa AA seqDB search
MEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQSMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHIVSASCSNASSSAVAETKEGDSDRDTSNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKRAIQAG
EELFFDYRYSQADALKYVGIERETDVL
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atggaaataccaaatccccctacctccaaatgtatcacttactggaaaagaaaagtgaaa
tctgaatacatgcgacttcgacaacttaaacggcttcaggcaaatatgggtgcaaaggct
ttgtatgtggcaaattttgcaaaggttcaagaaaaaacccagatcctcaatgaagaatgg
aagaagcttcgtgtccaaccagttcagtcaatgaagcctgtgagtggacacccttttctc
aaaaagtgtaccatagagagcattttcccgggatttgcaagccaacatatgttaatgagg
tcactgaacacagttgcattggttcccatcatgtattcctggtcccctctccaacagaac
tttatggtagaagatgagacggttttgtgcaatattccctacatgggagatgaagtgaaa
gaagaagatgagacttttattgaggagctgatcaataactatgatgggaaagtccatggt
gaagaagagatgatccctggatccgttctgattagtgatgctgtttttctggagttggtc
gatgccctgaatcagtactcagatgaggaggaggaagggcacaatgacacctcagatgga
aagcaggatgacagcaaagaagatctgccagtaacaagaaagagaaagcgacatgctatt
gaaggcaacaaaaagagttccaagaaacagttcccaaatgacatgatcttcagtgcaatt
gcctcaatgttccctgagaatggtgtcccagatgacatgaaggagaggtatcgagagcta
acagagatgtcagaccccaatgcacttccccctcagtgcacacccaacatcgatggcccc
aatgccaagtctgtgcagcgggagcaatctctgcactccttccacacacttttttgccgg
cgctgctttaaatacgactgcttccttcacccttttcatgccacccctaatgtatataaa
cgcaagaataaagaaatcaagattgaaccagaaccatgtggcacagactgcttccttttg
ctggaaggagcaaaggagtatgccatgctccacaacccccgctccaagtgctctggtcgt
cgccggagaaggcaccacatagtcagtgcttcctgctccaatgcctcatcctctgctgtg
gctgagactaaagaaggagacagtgacagggacacaagcaatgactgggcctccagttct
tcagaggctaactctcgctgtcagactcccacaaaacagaaggctagtccagccccacct
caactctgcgtagtggaagcaccctcggagcctgtggaatggactggggctgaagaatct
ctttttcgagtcttccatggcacctacttcaacaacttctgttcaatagccaggcttctg
gggaccaagacgtgcaagcaggtctttcagtttgcagtcaaagaatcacttatcctgaag
ctgccaacagatgagctcatgaacccctcacagaagaagaaaagaaagcacagattgtgg
gctgcacactgcaggaagattcagctgaagaaagataactcttccacacaagtgtacaac
taccaaccctgcgaccacccagaccgcccctgtgacagcacctgcccctgcatcatgact
cagaatttctgtgagaagttctgccagtgcaacccagactgtcagaatcgtttccctggc
tgtcgctgtaagacccagtgcaataccaagcaatgtccttgctatctggcagtgcgagaa
tgtgaccctgacctgtgtctcacctgtggggcctcagagcactgggactgcaaggtggtt
tcctgtaaaaactgcagcatccagcgtggccttaagaagcacctgctgctggccccctct
gatgtggccggatggggcaccttcataaaggagtctgtgcagaagaacgaattcatttct
gaatactgtggtgagctcatctctcaggatgaggctgatcgacgcggaaaggtctatgac
aaatacatgtccagcttcctcttcaacctcaataatgattttgtagtggatgctactcgg
aaaggaaacaaaattcgatttgcaaatcattcagtgaatcccaactgttatgccaaagtg
gtcatggtgaatggagaccatcggattgggatctttgccaagagggcaattcaagctggc
gaagagctcttctttgattacaggtacagccaagctgatgctctcaagtacgtggggatc
gagagggagaccgacgtcctttag

DBGET integrated database retrieval system