KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126515Help
Entry
101126515         CDS       T02442                                 

Gene name
EZH1
Definition
histone-lysine N-methyltransferase EZH1 isoform 1
Orthology
K17451  
histone-lysine N-methyltransferase EZH1 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101126515 (EZH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 753 aa AA seqDB search
MEDYSKMEIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQ
ILNEEWKKLRVQPVQSMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSW
SPLQQNFMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDA
VFLELVDALNQYSDEEEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGNKKSSKKQFPND
MIFSAIASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSF
HTLFCRRCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPR
SKCSGRRRRRHHIVSASCSNASSSAVAETKEGDSDRDTSNDWASSSSEANSRCQTPTKQK
ASPAPPQLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVK
ESLILKLPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDST
CPCIMTQNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEH
WDCKVVSCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADR
RGKVYDKYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAK
RAIQAGEELFFDYRYSQADALKYVGIERETDVL
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atggaggattacagcaagatggaaataccaaatccccctacctccaaatgtatcacttac
tggaaaagaaaagtgaaatctgaatacatgcgacttcgacaacttaaacggcttcaggca
aatatgggtgcaaaggctttgtatgtggcaaattttgcaaaggttcaagaaaaaacccag
atcctcaatgaagaatggaagaagcttcgtgtccaaccagttcagtcaatgaagcctgtg
agtggacacccttttctcaaaaagtgtaccatagagagcattttcccgggatttgcaagc
caacatatgttaatgaggtcactgaacacagttgcattggttcccatcatgtattcctgg
tcccctctccaacagaactttatggtagaagatgagacggttttgtgcaatattccctac
atgggagatgaagtgaaagaagaagatgagacttttattgaggagctgatcaataactat
gatgggaaagtccatggtgaagaagagatgatccctggatccgttctgattagtgatgct
gtttttctggagttggtcgatgccctgaatcagtactcagatgaggaggaggaagggcac
aatgacacctcagatggaaagcaggatgacagcaaagaagatctgccagtaacaagaaag
agaaagcgacatgctattgaaggcaacaaaaagagttccaagaaacagttcccaaatgac
atgatcttcagtgcaattgcctcaatgttccctgagaatggtgtcccagatgacatgaag
gagaggtatcgagagctaacagagatgtcagaccccaatgcacttccccctcagtgcaca
cccaacatcgatggccccaatgccaagtctgtgcagcgggagcaatctctgcactccttc
cacacacttttttgccggcgctgctttaaatacgactgcttccttcacccttttcatgcc
acccctaatgtatataaacgcaagaataaagaaatcaagattgaaccagaaccatgtggc
acagactgcttccttttgctggaaggagcaaaggagtatgccatgctccacaacccccgc
tccaagtgctctggtcgtcgccggagaaggcaccacatagtcagtgcttcctgctccaat
gcctcatcctctgctgtggctgagactaaagaaggagacagtgacagggacacaagcaat
gactgggcctccagttcttcagaggctaactctcgctgtcagactcccacaaaacagaag
gctagtccagccccacctcaactctgcgtagtggaagcaccctcggagcctgtggaatgg
actggggctgaagaatctctttttcgagtcttccatggcacctacttcaacaacttctgt
tcaatagccaggcttctggggaccaagacgtgcaagcaggtctttcagtttgcagtcaaa
gaatcacttatcctgaagctgccaacagatgagctcatgaacccctcacagaagaagaaa
agaaagcacagattgtgggctgcacactgcaggaagattcagctgaagaaagataactct
tccacacaagtgtacaactaccaaccctgcgaccacccagaccgcccctgtgacagcacc
tgcccctgcatcatgactcagaatttctgtgagaagttctgccagtgcaacccagactgt
cagaatcgtttccctggctgtcgctgtaagacccagtgcaataccaagcaatgtccttgc
tatctggcagtgcgagaatgtgaccctgacctgtgtctcacctgtggggcctcagagcac
tgggactgcaaggtggtttcctgtaaaaactgcagcatccagcgtggccttaagaagcac
ctgctgctggccccctctgatgtggccggatggggcaccttcataaaggagtctgtgcag
aagaacgaattcatttctgaatactgtggtgagctcatctctcaggatgaggctgatcga
cgcggaaaggtctatgacaaatacatgtccagcttcctcttcaacctcaataatgatttt
gtagtggatgctactcggaaaggaaacaaaattcgatttgcaaatcattcagtgaatccc
aactgttatgccaaagtggtcatggtgaatggagaccatcggattgggatctttgccaag
agggcaattcaagctggcgaagagctcttctttgattacaggtacagccaagctgatgct
ctcaagtacgtggggatcgagagggagaccgacgtcctttag

DBGET integrated database retrieval system