KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126538Help
Entry
101126538         CDS       T02442                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like isoform 1
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101126538
Enzymes [BR:ggo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     101126538
Peptidases [BR:ggo01002]
 Cysteine Peptidases
  Family C44
   101126538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 561 aa AA seqDB search
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVKKYPYLWLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGV
FAFVLLDTANKKVFLGRDTYGVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCRDEPLHTLYDNVEKLFPGFEIETVKNNLRILFN
NAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAAR
KVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNS
WFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPK
WINATDPSARTLTHYKSAVKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatttgggccctgtttggcagtgatgactgcctttctgttcagtgtctgagt
gctatgaagattgcacacagaggtccagacgcattccgttttgagaatgtcaatggatac
accaactgctgctttggatttcaccggttggcggtagttgacccgctgtttggaatgcag
ccaattcgagtgaagaaatatccgtatttgtggctctgttataatggtgaaatctacaac
cataagaagatgcaacagcattttgaatttgaataccagaccaaagtggatggtgagata
atccttcatctttatgacaaaggaggaattgagcaaacaatttgtatgctggatggtgtg
tttgcatttgttttactggatactgccaataagaaagtgttcctgggtagagatacatat
ggagtcagacctttgtttaaagcaatgacagaagatggatttttggctgtatgttcagaa
gctaaaggtcttgttacattgaagcactccgcgactccctttttaaaagtggagcctttt
cttcctggacactacgaagttttggatttaaagccaaatggcaaagttgcatccgtggaa
atggttaaatatcatcactgtcgggatgaacccctgcacaccctctatgacaatgtggag
aaactctttccaggttttgagatagaaactgtgaagaacaacctcaggatcctttttaat
aatgctgtaaagaaacgtttgatgacagacagaaggattggctgccttttatcagggggc
ttggactccagcttggttgctgccactctgttgaagcagctgaaagaggcccaagtacag
tatcctctccagacatttgcaattggcatggaagacagccccgatttactggctgctaga
aaggtggcagatcatattggaagtgaacattatgaagtcctttttaactctgaggaaggc
attcaggctctggatgaagtcatattttccttggaaacttatgacattacaacagttcgt
gcttcagtaggtatgtatttaatttccaagtatattcggaagaacacagatagcgtggtg
atcttctctggagaaggatcagatgaacttacgcagggttacatatattttcacaaggct
ccttctcctgaaaaagccgaggaggagagtgagaggcttctgagggaactctatttgttt
gatgttctccgcgcagatcgaactactgctgcccatggtcttgaactgagagtcccattt
ctagatcatcgattttcttcctattacttgtctctgccaccagaaatgagaattccaaag
aatgggatagaaaaacatctcctgagagagacgtttgaggattccaatctgatacccaaa
gagattctctggcgaccaaaagaagccttcagtgatggaataacttcagttaagaattcc
tggtttaagattttacaggaatacgttgaacatcaggttgatgatgcaatgatggcaaat
gcagcccagaaatttcccttcaatactcctaaaaccaaagaaggatattactaccgtcaa
gtctttgaacgccattacccaggccgggctgactggctgagccattactggatgcccaag
tggatcaatgccactgacccttctgcccgcacactgacccactacaagtcagctgtcaaa
gcttag

DBGET integrated database retrieval system