KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127127Help
Entry
101127127         CDS       T02442                                 

Gene name
PPT2
Definition
lysosomal thioesterase PPT2
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ggo01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ggo00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:ggo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 240 aa AA seqDB search
MKSCGSMLRLWGQRLPAAWVLLLLPFLPLLLLAAPAPHRASYKPVIVVHGLFDSSYSFRH
LLEYINETHPGTVVTVLDLFDGRESLRPLWEQVQGFREAVVPIMAKAPQGVHLICYSQDP
HHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQSSFFGFY
DANETVLEMEEQLVYLRDSFGLKTLLARGAIVRCPMAGISHTAWHSNRTLYETCIEPWLS
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaagagttgcgggagcatgctgcggctctgggggcagcggctccccgcggcgtgggtc
ctgcttctgttgcctttcctgccgctgctgctgcttgcggcccccgcgccccaccgcgcg
tcctacaagccggtcatcgtggtgcatgggctcttcgacagctcgtacagcttccgccac
ctgctggaatacatcaatgagacacaccccgggactgtggtgacagtgctcgatctcttc
gatgggagagagagcttgcgacccctgtgggaacaggtgcaagggttccgagaggctgtg
gtccccatcatggcaaaggcccctcaaggggtgcatctcatctgctactcgcaggatccc
caccacgatgacttgtacctcaatgccagcagcttcctggccctgatcaatggggaaaga
gaccatcccaatgccacagtatggcggaagaactttcttcgtgtgggccacctggtgctg
attgggggccctgatgatggtgttattactccctggcagtccagcttctttggtttctat
gatgcaaatgagaccgtcctggagatggaggagcaactggtttatctgcgggattctttt
gggttgaagactctattggcccggggggccatagtgaggtgtccaatggccgggatctcc
cacacagcctggcactccaaccgtaccctttatgagacctgcattgaaccttggctctcc
tga

DBGET integrated database retrieval system