KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127437Help
Entry
101127437         CDS       T02442                                 

Gene name
GBA
Definition
(RefSeq) glucosylceramidase beta
  KO
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101127437 (GBA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101127437 (GBA)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101127437 (GBA)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101127437 (GBA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
1
AA seq 397 aa AA seqDB search
MEFSSPSREECPKPSGRVSIMAGSLTGLLLLQAVSWASGECLQPLXEQKQWSSDGAEYRT
IQANCTGTGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRA
LQLAQRPVSLLASPWTSPTWLKTNGAVNGKGSLKGQPGDIYHQTWARYFVKFLDAYVEHK
LQFWAVTAENEPSAGLLSGYPFQCLGFTPEHQRDFIARDLGPTLANSTHHNVRLLMLDDQ
RLLLPHWAKVVLTDPEAAKLCGLQVLGAECAARLLGSRDAVQPQHHHKPPVPCGRLDRLE
PIIVDITKHMFYKQPMFYHLGHFSKFIPEGSERVGLVASQKNDLDAVALMHPDGSTVVVV
LNRSSKDVPLTIKDPAVGFLETISPGYSIHTYLWRRQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggagttttcaagtccttccagagaggaatgtcccaagccttcgggtagggtaagcatc
atggctggcagcctcacaggattgcttctacttcaggcagtgtcgtgggcatcaggtgag
tgccttcagccgctataagagcagaagcagtggtcatcggatggagctgagtacaggacc
atacaggctaattgcaccggcacaggaatcggatataacatcatccgggtacccatggcc
agctgtgacttctccatccgcacctacacctatgcagacacccctgatgatttccagttg
cacaacttcagcctcccagaggaagataccaagctcaagatacccctgattcaccgagcc
ctgcagttggcccagcgtcccgtttcactccttgccagcccctggacatcacccacttgg
ctcaagaccaatggagcagtgaatgggaaggggtcactcaagggacagcccggagacatc
taccaccagacctgggccagatactttgtgaagttcctggatgcctatgttgagcacaag
ttacagttctgggcagtgacagctgaaaatgagccttctgctgggctgttgagtggatac
cccttccagtgcctgggcttcacccctgaacatcagcgagacttcattgcccgtgaccta
ggtcctaccctcgccaacagtactcaccacaatgtccgcctactcatgctggatgaccaa
cgcttgctgctgccccactgggcaaaggtggtactgacagacccagaagcagctaagctg
tgtgggctccaagttctgggagcagagtgtgcggctaggctcctgggatcgagggatgca
gtacagccacagcatcatcacaaacctcctgtaccatgtggtcggctggaccgactggaa
cccatcattgtagacatcaccaagcacatgttttacaaacagcccatgttctaccacctt
ggccacttcagcaagttcattcctgagggctcggagagagtggggctggttgccagtcag
aagaacgacctggacgcagtggcactgatgcatcccgatggctctactgttgtggtcgtg
ctaaaccgctcctctaaggatgtgcctcttaccatcaaggatcctgctgtgggcttcctg
gagacaatctcacctggctactccattcacacctacctgtggcgtcgccagtga

DBGET integrated database retrieval system