KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127624Help
Entry
101127624         CDS       T02442                                 

Gene name
SIRT6
Definition
NAD-dependent protein deacetylase sirtuin-6 isoform 1
Orthology
K11416  
mono-ADP-ribosyltransferase sirtuin 6 [EC:2.4.2.31]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101127624 (SIRT6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
19
AA seq 355 aa AA seqDB search
MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSNVVFHTGAGISTASG
IPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHV
RSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRACRGE
LRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVN
LQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPK
EESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAEAVPS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgaattacgcggcggggctgtcgccgtacgcggacaagggcaagtgcggcctc
ccggagatcttcgaccccccggaggagctggagcggaaggtgtgggaactggcgaggctg
gtctggcagtcttccaatgtggtgttccacacgggtgccggcatcagcactgcctctggc
atccccgacttcaggggtccccacggagtctggaccatggaggagcgaggtctggccccc
aagttcgacaccacctttgagagcgcgcggcccacgcagacccacatggcgctggtgcag
ctggagcgcgtgggcctcctccgcttcctggtcagccagaacgtggacgggctccatgtg
cgctcaggcttccccagggacaaactggcagagcttcacgggaacatgtttgtggaagaa
tgtgccaagtgtaagacgcagtacgtccgggacacagtcgtgggcaccatgggcctgaag
gccacgggccggctctgcaccgtggctaaggcaagggggctgcgagcctgcaggggagag
ctgagggacaccatcctagactgggaggactccctgcctgaccgggacctggcactcgcc
gatgaggccagcaggaacgccgacctgtccatcacgctgggtacgtcgctgcagatccgg
cccagcgggaacctgccgctggctaccaagcgccggggaggccgcctggtcatcgtcaac
ctgcagcccaccaagcacgaccgccatgctgacctccgcatccatggctacgttgacgag
gtcatgacccggctcatgaagcacctggggctggagatccccgcctgggatggcccccgt
gtgctggagagggcgctgccacccctgccccgcccgcccacccccaagctggagcccaag
gaggaatctcccacccggatcaacggctctatccccgccggccccaagcaggagccctgc
gcccagcacaacggctcagagcccgccagccccaaacgggagcggcccaccagtcctgcc
cctcacagaccccccaaaagggtgaaggctgaggcggtccccagctga

DBGET integrated database retrieval system