KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127850Help
Entry
101127850         CDS       T02442                                 

Gene name
SPHK1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101127850 (SPHK1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101127850 (SPHK1)
   04371 Apelin signaling pathway
    101127850 (SPHK1)
   04020 Calcium signaling pathway
    101127850 (SPHK1)
   04072 Phospholipase D signaling pathway
    101127850 (SPHK1)
   04071 Sphingolipid signaling pathway
    101127850 (SPHK1)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    101127850 (SPHK1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    101127850 (SPHK1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     101127850 (SPHK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
ENSGGOG00000016884
Position
5
AA seq 472 aa AA seqDB search
MSAQVLGFLRTRSWTPLPLAAPRDPAAAGNDAGAPTATAPGGEGEPHSRPCDARLGSTDK
ELKAGAAATGSAPTAPGTPWQREPRVEVMDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQ
LFRSHVQPLLAEAEISFTLMLTERRNHARELVLSEELGRWDALVVMSGDGLMHEVVNGLM
ERPDWETAIQKPLCSLPAGSGNALAASLNHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNL
LSLHTASGLRLFSVLSLAWGFIADVDLESEKYRRLGEMRFTLGTFLRLAALRTYRGRLAY
LPVGRVGSKTPASPVVVQQGPVDAHLVPLEEPVPSHWTVVPDQDFVLVLALLHSHLGSEM
FAAPMGRCAAGVMHLFYVRAGVSRAMLLRLFLAMEKGRHMEYECPYLVYVPVVAFRLEPK
DGKGVFAVDGELMVSEAVQGQVHPNYFWMVSGCVEPPPSWKPQQTPPPEEPL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctcaagttctgggatttttacgcacacgcagctggactcccctccccctggca
gccccgagggatccagccgccgcagggaatgacgccggtgctcctacagccacggctccg
ggcggggaaggcgagccccacagccggccctgcgacgcccgcctgggcagcaccgataag
gagctgaaggcaggagccgccgccacgggcagcgcccccacagcgccagggaccccctgg
cagcgggagccgcgggtcgaggttatggatccagcgggcggcccccggggcgtgctcccg
cggccctgccgcgtgctggtgctgctgaacccgcgcggcggcaagggcaaggccctgcag
ctcttccggagtcacgtgcagccccttttggctgaggctgaaatctccttcacgctgatg
cttactgagcggcggaaccacgcgcgggagctggtgctgtcggaggagctgggccgctgg
gacgctctggtggtcatgtctggagacgggctgatgcacgaggtggtgaacgggctcatg
gagcggcctgactgggagaccgccatccagaagcccctgtgtagcctcccagcaggctct
ggcaacgcgctggcagcttccttgaaccattatgctggctatgagcaggtcaccaatgaa
gacctcctgaccaactgcacactattgctgtgccgccggctactgtcgcccatgaacctg
ctgtctctgcacacggcttcggggctgcgcctcttctctgtgcttagcctggcctggggc
ttcattgctgatgtggacctagagagtgagaagtatcggcgtctgggggagatgcgcttc
actctgggcaccttcctgcgtctggcagccctgcgcacctaccgtggccgattggcctac
ctccctgtaggaagagtcggttccaagacacctgcctcccccgttgtggtccagcagggc
ccggtagatgcacaccttgtgccactggaggagccagtgccctctcactggacagtggtg
cccgaccaggactttgtgctagtcttggcactgctgcactcgcacctgggcagtgagatg
tttgctgcacccatgggccgctgtgcagctggtgtcatgcatctgttctacgtgcgggcg
ggcgtgtctcgcgccatgctgctgcgcctcttcctggccatggagaagggcaggcatatg
gagtatgaatgcccctacttggtatatgtgcccgtggtcgccttccgcttggagcccaag
gatgggaaaggtgtgtttgcagtggatggggaattgatggttagcgaggccgtgcagggc
caggtgcacccaaactacttctggatggtcagtggttgcgtggagcccccgcccagctgg
aagccccagcagacgccaccgccagaagagcccttgtga

DBGET integrated database retrieval system