KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127850Help
Entry
101127850         CDS       T02442                                 

Gene name
SPHK1
Definition
sphingosine kinase 1 isoform 1
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ggo00600]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:ggo04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:ggo04020]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:ggo04666]
Human Diseases; Infectious diseases; Tuberculosis [PATH:ggo05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 384 aa AA seqDB search
MDPAGGPRGVLPRPCRVLVLLNPRGGKGKALQLFRSHVQPLLAEAEISFTLMLTERRNHA
RELVLSEELGRWDALVVMSGDGLMHEVVNGLMERPDWETAIQKPLCSLPAGSGNALAASL
NHYAGYEQVTNEDLLTNCTLLLCRRLLSPMNLLSLHTASGLRLFSVLSLAWGFIADVDLE
SEKYRRLGEMRFTLGTFLRLAALRTYRGRLAYLPVGRVGSKTPASPVVVQQGPVDAHLVP
LEEPVPSHWTVVPDQDFVLVLALLHSHLGSEMFAAPMGRCAAGVMHLFYVRAGVSRAMLL
RLFLAMEKGRHMEYECPYLVYVPVVAFRLEPKDGKGVFAVDGELMVSEAVQGQVHPNYFW
MVSGCVEPPPSWKPQQTPPPEEPL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggatccagcgggcggcccccggggcgtgctcccgcggccctgccgcgtgctggtgctg
ctgaacccgcgcggcggcaagggcaaggccctgcagctcttccggagtcacgtgcagccc
cttttggctgaggctgaaatctccttcacgctgatgcttactgagcggcggaaccacgcg
cgggagctggtgctgtcggaggagctgggccgctgggacgctctggtggtcatgtctgga
gacgggctgatgcacgaggtggtgaacgggctcatggagcggcctgactgggagaccgcc
atccagaagcccctgtgtagcctcccagcaggctctggcaacgcgctggcagcttccttg
aaccattatgctggctatgagcaggtcaccaatgaagacctcctgaccaactgcacacta
ttgctgtgccgccggctactgtcgcccatgaacctgctgtctctgcacacggcttcgggg
ctgcgcctcttctctgtgcttagcctggcctggggcttcattgctgatgtggacctagag
agtgagaagtatcggcgtctgggggagatgcgcttcactctgggcaccttcctgcgtctg
gcagccctgcgcacctaccgtggccgattggcctacctccctgtaggaagagtcggttcc
aagacacctgcctcccccgttgtggtccagcagggcccggtagatgcacaccttgtgcca
ctggaggagccagtgccctctcactggacagtggtgcccgaccaggactttgtgctagtc
ttggcactgctgcactcgcacctgggcagtgagatgtttgctgcacccatgggccgctgt
gcagctggtgtcatgcatctgttctacgtgcgggcgggcgtgtctcgcgccatgctgctg
cgcctcttcctggccatggagaagggcaggcatatggagtatgaatgcccctacttggta
tatgtgcccgtggtcgccttccgcttggagcccaaggatgggaaaggtgtgtttgcagtg
gatggggaattgatggttagcgaggccgtgcagggccaggtgcacccaaactacttctgg
atggtcagtggttgcgtggagcccccgcccagctggaagccccagcagacgccaccgcca
gaagagcccttgtga

DBGET integrated database retrieval system