KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129084Help
Entry
101129084         CDS       T02442                                 

Gene name
MAPK15
Definition
mitogen-activated protein kinase 15
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 544 aa AA seqDB search
MCTAVDPRIVRRYLLRRQLGQGAYGIVWKAVDRRTGEVVAIKKIFDAFRDKTDAQRTFRE
ITLLQEFGDHPNIISLLDVIRAENDRDIYLVFEFMDTDLNAVIRKGGLLQDVHVRSIFYQ
LLRATRFLHSGHVVHRDQKPSNVLLDANCTVKLCDFGLARSLGDLPEGPEDQAVTEYVAT
RWYRAPEVLLSSHRYTLGVDMWSLGCILGEMLRGRPLFPGTSTLHQLELILETIPPPSEE
DLLALGSGCRASVLHHLGSRPRQTLDALLPPDTSPEALDLLRRLLVFAPDKRLSATQALQ
HPYVQRFHCPSDEWAREADVRLRAHEGVQLSVPEYRSRVYQMILEYGGSSGTSREKGPEG
VSPSQAHMHKPRADPQLPSRTSVQGPRPRPQSSPGHDPAEHESPHAAKNVPRQNSAPLLQ
TALLGNGERPPGAKEAPPLTLSLVKPSGRGAAPSLTSQAAAQVANQALIRGDWNRGGGVR
VASAQQVPPRLPPEARPGRRMFSTSALQGAQGGARALLGGYSQAYGTICHSALGHLPLLE
GHHV
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaccgcagtggaccctcgcattgtccggagatacctactcaggcggcagctcggg
cagggagcctatggcattgtgtggaaggcagtggaccggaggactggtgaggtcgtggcc
atcaagaaaatctttgatgcttttagggataagacagatgcccagagaacattccgggaa
atcacgctcctccaggagtttggggaccatcccaacatcatcagcctccttgacgtgatc
cgggcagagaacgacagggacatttacctggtgtttgagtttatggacactgacctgaac
gcagtcatccggaagggcggcctgctgcaggacgtccacgtgcgctccatcttctaccag
ctcctgcgggccacccggttcctccactcggggcacgttgtgcaccgggaccagaagccg
tccaatgtgctcctggatgccaactgcacagtgaagctgtgtgactttggcctggcccgc
tccctgggcgacctccccgaggggcctgaggaccaggccgtgacagagtacgtggccaca
cgctggtaccgagcaccggaggtgctgctctcttcacaccgatacacccttggggtggac
atgtggagtctgggttgtatcctgggggagatgctgcgggggagacccctgttcccgggc
acgtccaccctccaccagctggagctgatcctggagaccatcccaccgccatctgaggag
gacctcctggctctcggctcaggctgccgtgcctctgtactgcaccacctggggtcccgg
ccacgacagacgctggatgccctcctaccgccagacacctccccagaggccttggacctc
cttaggcgactcctggtgttcgccccggacaagcggttaagcgcgacccaggcactgcag
cacccctacgtgcagaggttccactgccccagcgacgagtgggcacgagaggcagatgtg
cggctccgggcacacgaaggggtccagctctctgtgcctgagtaccgtagccgcgtctat
cagatgatcctggagtatggaggcagcagcggcacctcgagagagaagggcccggagggt
gtctccccaagccaggcacacatgcacaaacccagagccgaccctcagctgccttctagg
acatctgtgcagggtcccagacccaggccccagagcagcccaggccatgaccccgccgag
cacgagtccccccatgcagccaagaacgttcccaggcagaactctgctcccctgctccaa
actgcactcctagggaatggggaaaggccccctggggcaaaggaagcgccccccttgaca
ctctcgctggtgaagccaagcgggaggggagctgcgccctccctgacctcccaggctgcg
gctcaggtggccaaccaggccctgatccggggtgactggaaccggggcggtggggtgagg
gtggccagcgcacaacaggtccctccccggcttcctccggaggcccggcccggccggagg
atgttcagcacctctgccttgcagggtgcccaggggggtgccagggctttgcttggaggc
tactcccaagcctacgggactatctgccactcggcactgggccacctgcccctgctggag
gggcaccatgtgtga

DBGET integrated database retrieval system