KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129357Help
Entry
101129357         CDS       T02442                                 

Gene name
PLCB3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Chemokine signaling pathway
Phosphatidylinositol signaling system
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Apelin signaling pathway
Gap junction
Platelet activation
NOD-like receptor signaling pathway
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Dopaminergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
Insulin secretion
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Renin secretion
Aldosterone synthesis and secretion
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Endocrine and other factor-regulated calcium reabsorption
Salivary secretion
Gastric acid secretion
Pancreatic secretion
Alzheimer's disease
Huntington's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Amoebiasis
Pathways in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101129357 (PLCB3)
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101129357 (PLCB3)
   04310 Wnt signaling pathway
    101129357 (PLCB3)
   04371 Apelin signaling pathway
    101129357 (PLCB3)
   04020 Calcium signaling pathway
    101129357 (PLCB3)
   04070 Phosphatidylinositol signaling system
    101129357 (PLCB3)
   04072 Phospholipase D signaling pathway
    101129357 (PLCB3)
   04071 Sphingolipid signaling pathway
    101129357 (PLCB3)
   04022 cGMP - PKG signaling pathway
    101129357 (PLCB3)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101129357 (PLCB3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101129357 (PLCB3)
   04621 NOD-like receptor signaling pathway
    101129357 (PLCB3)
   04062 Chemokine signaling pathway
    101129357 (PLCB3)
  Endocrine system
   04911 Insulin secretion
    101129357 (PLCB3)
   04922 Glucagon signaling pathway
    101129357 (PLCB3)
   04912 GnRH signaling pathway
    101129357 (PLCB3)
   04915 Estrogen signaling pathway
    101129357 (PLCB3)
   04921 Oxytocin signaling pathway
    101129357 (PLCB3)
   04926 Relaxin signaling pathway
    101129357 (PLCB3)
   04918 Thyroid hormone synthesis
    101129357 (PLCB3)
   04919 Thyroid hormone signaling pathway
    101129357 (PLCB3)
   04916 Melanogenesis
    101129357 (PLCB3)
   04924 Renin secretion
    101129357 (PLCB3)
   04925 Aldosterone synthesis and secretion
    101129357 (PLCB3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101129357 (PLCB3)
   04270 Vascular smooth muscle contraction
    101129357 (PLCB3)
  Digestive system
   04970 Salivary secretion
    101129357 (PLCB3)
   04971 Gastric acid secretion
    101129357 (PLCB3)
   04972 Pancreatic secretion
    101129357 (PLCB3)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101129357 (PLCB3)
  Nervous system
   04724 Glutamatergic synapse
    101129357 (PLCB3)
   04725 Cholinergic synapse
    101129357 (PLCB3)
   04728 Dopaminergic synapse
    101129357 (PLCB3)
   04726 Serotonergic synapse
    101129357 (PLCB3)
   04720 Long-term potentiation
    101129357 (PLCB3)
   04730 Long-term depression
    101129357 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    101129357 (PLCB3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101129357 (PLCB3)
  Environmental adaptation
   04713 Circadian entrainment
    101129357 (PLCB3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101129357 (PLCB3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101129357 (PLCB3)
   05016 Huntington's disease
    101129357 (PLCB3)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101129357 (PLCB3)
  Infectious diseases
   05146 Amoebiasis
    101129357 (PLCB3)
   05142 Chagas disease (American trypanosomiasis)
    101129357 (PLCB3)
   05143 African trypanosomiasis
    101129357 (PLCB3)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101129357 (PLCB3)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101129357 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101129357 (PLCB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
11
AA seq 1234 aa AA seqDB search
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
SGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPTSTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgactctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccggtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctattcaagctggctatg
aacatcctggctcagaacgcctctcggaacaccttcctgcgcaaagcatacacgaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaaattcaaccggagt
gagtccatccggcccgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgtgacccgagactcaac
gaagtgctgtacccgcccctgcggccctcccaggcccggctgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcacggacatgacc
cagccactgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactgctatggggctgccgctgc
gtggagctggatgtgtggaagggacggccgcccgaggaggaacccttcattacccatggc
ttcaccatgaccacagaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacctcgccctaccccgtcatcctctccttcgagaaccatgtggactcggcaaag
caacaggcaaagatggctgagtactgccgctccatctttggagacgcgctactcatcgag
cctctggacaagtacccgctggccccaggcgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcaccgacccagcgcaggtggcccagacagc
tccgggcgcaagcggcccctggagcagagcaattctgccctgagtgagagctccgcggcc
actgagccctcctccccgcagcttgggtctcccagctctgacagctgcccaggcctgagc
aacggggaggaggtagggcttgagaagcccagcctggagcctcagaagtctctgggcgac
gagggcctgaaccggggcccctatgttcttggacctgctgaccgtgaggatgaggaggaa
gatgaagaagaggaggaacagacagaccccaaaaagccaactacagatgagggcacagcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgagcctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactatatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagaccctcgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggccggacaagtccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcagggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggacgaagagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcacttcgcatcgcagcctttgag
gaggggggtaaattcgtagggcaccggatcctgcctgtctctgccatccgctccggatac
cactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctgctcatc
tacaccgaagcctcggactacattcctgacgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggagagagtgaggctcaggctggccaagagacgtgccaggacacccagtctcagcagctg
gggtctcagccgtcctcaaaccccacccctagcccactggatgcctccccccgccggccc
cctggccccaccacctcccctaccagcacctccctcagcagcccagggcagcgcgacgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctttggtcaagctccggagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggacggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggtggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggaacac
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggagctgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagatgagggacaagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgccggagcctgctgggcgagatgccggaggggctgggg
gacgggcctctggtggcctgtgccagcaacggtcatgcacccgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacgcagctctga

DBGET integrated database retrieval system