KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129366Help
Entry
101129366         CDS       T02442                                 

Gene name
MLL
Definition
histone-lysine N-methyltransferase MLL
Orthology
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101129366 (MLL)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    101129366 (MLL)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101129366 (MLL)
Transcription factors [BR:ggo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101129366 (MLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 3837 aa AA seqDB search
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAA
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGEDEQFLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPR
SGSDRNSAILSDPSVFSPLNKSETKSGDKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKD
ISELPKGNKEDSLKKIKRTPSATFQQATKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIV
RRRGRPPSTERIKTPSGLLINSELEKPQKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRI
IPSSKRTDATIAKQLLQRAKKGAQKKIEKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSR
IIKTPRRFIEDEDYDPPIKIARLESTPNSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSS
SPSVDTSTDSQASEEIQVLPEERSDTPEVHPPLPISQSPENESNDRRSRRYSVSERSFGS
RTTKKLSTLQSAPQQQTSSSPPPPLLTPPPPLQPASSISDHTPWLMPPTIPLASPFLPAS
TAPMQGKRKSILREPTFRWTSLKHSRSEPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPED
VGFASGFSASGTAASARLFSPLHSGTRFDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSN
RTSAGTSSSGVSNRKRKRKVFSPIRSEPRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSL
SISVSPLATSALNPTFTFPSHSLTQSGESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFT
PGSQTERGRNKDKVPEELSKDRDADKSVEKDKSRERDREREKENKRESRKEKRKKGSEIQ
SSSALYPVGRVSKEKVVGEDVATSSSAKKATGRKKSSSHDSGTDITSVTLGDTTAVKTKI
LIKKGRGNLEKTNLDLGPTAPSLEKEKTLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTD
KRVASLLKKAKAQLCKIEKSKSLKQTDQPKAQGQESDSSETSVRGPRIKHVCRRAAVALG
RKRAVFPDDMPTLSALPWEEREKILSSMGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKA
PQEPPVKKGRRSRRCGQCPGCQVPEDCGVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWM
PSKAYLQKQAKAVKKKEKKSKTSEKKDSKESSVVKNVVDSSQKPTPSAREDPAPKKSSSE
PPPRKPVEEKSEEGNVSAPGPESKQATTPASRKSSKQVSQPALVIPPQPPTTGPPRKELP
KTTPSEPKKKQPPPPESGPEQSKQKKVAPRPSIPVKQKPKEKQLLECNKCRNSYHPECLG
PNYPTKPTKKKKVWICTKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPL
CDKCYDDDDYESKMMQCGKCDRWVHSKCENLSDEMYEILSNLPESVAYTCVNCTERHPAE
WRLALEKELQISLKQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDP
PVLTEVSKQDDQQPLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKAN
SMVKSFFIRQMERVFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREEN
SHTEQPPLMKKIIPAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNR
QCALCLTYGDDSANDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQL
RCEFCQKPGATVGCCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGF
EVFRRVFVDFEGISLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQC
SRVYWSTTDARKRCVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQ
NTAEIISPPSPDRPPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPT
THEIVTVGDPLLSSGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTIG
TATDLESSAKVVDHVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQS
SASDLASKSSSLKGEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSF
AEPSSVSFSSKEALSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRS
SIINEHMGSSSRDRRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTP
EYMGQRPCNNVSSDKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMEN
ESQSKNALKESSPASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSDNYQNL
PVQDRNLMLPDGPKPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSS
TGKKRGKRSAEGQVDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDL
PKISQLDGVDDGTESDTSVTATTRKSSQVPKRNGKENGTENLKIDRPEDAGEKEHVTKSS
VGHKNEPKMDNCHSVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKS
DSDNNNSDDCGNILPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDM
GLFEVFSQQLPTTEPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAV
ISDSGEKRVTITEKSVASSEGDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGS
VEQGHGNNQDLTRNSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHL
KPATEKLIVVNQNMQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGSGLTL
TTGLNPSLPTSQSLFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPP
PDPQLLVSESSQRTDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSN
MTLINFTPSQLPNHPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAA
TAAGTSTISQDTSHLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLG
TPDIGSISNLLIKASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAMTAASSICVLPS
TQTTGITAASPSGEADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPN
SMGLEQNKALSSAVQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGN
GKKHKVSHLRTSSEAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPSGQVA
VLPEVQVTQNPANEQESTEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFE
ISSDDGFQICAESIEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIE
QLSGAKHCRNYKFRFHKPEEANEPPLNPHGSARAEVHLRQSAFDMFNFLASKHRQPPEYN
PNDEEEEEVQLKSARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAG
EMVIEYAGNVIRSIQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPN
CYSRVINIDGQKHIVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
NT seq 11514 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggcggcggc
ggcggggggcggcggggcctcgggggcgccccgcggcaacgcgtcccggccctgctgctt
ccccccgggcccccggtcggcggtggcggccccggggcgcccccctcccccccggctgcg
gcggccgcggcggcggcggcgggaagcagcggggctggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctct
tcagggccggccctgctccgggtgggcccgggcttcgacgcggcgctgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagaggatgagcaattcttaggttttggctcagatgaagaagtcagagtgcga
agtcccacaaggtctccttcagttaaaactagtcctcgaaaacctcgtgggagacctaga
agtggctctgaccgaaattcagctatcctctcagatccatctgtgttttcccctctaaat
aaatcagagaccaaatctggagataagatcaagaagaaagattctaaaagtatagaaaag
aagagaggaagacctcccaccttccctggagtaaaaatcaaaataacacatggaaaggac
atttcagagttaccaaagggaaacaaagaagatagcctgaaaaaaattaaaaggacacct
tctgctacgtttcagcaagccacaaagattaaaaaattaagagcaggtaaactctctcct
ctcaagtctaagtttaagacagggaagcttcaaataggaaggaagggggtacaaattgta
cgacggagaggaaggcctccatcaacagaaaggataaagaccccttcgggtctcctcatt
aattctgaactggaaaagccccagaaagtccggaaagacaaggaaggaacacctccactt
acaaaagaagataagacagttgtcagacaaagccctcgaaggattaagccagttaggatt
attccttcttcaaaaaggacagatgcaaccattgctaagcaactcttacagagggcaaaa
aagggggctcaaaagaaaattgaaaaagaagcagctcagctgcagggaagaaaggtgaag
acacaggtcaaaaatattcgacagttcatcatgcctgttgtcagtgctatctcctcgcgg
atcattaagacccctcggcggtttatagaggatgaggattatgaccctccaattaaaatt
gcccgattagagtctacaccgaatagtagattcagtgccccgtcctgtggatcttctgaa
aaatcaagtgcagcttctcagcactcctctcaaatgtcttcagactcctctcgatctagt
agccccagtgttgatacctccacagactctcaggcttctgaggagattcaggtacttcct
gaggagcgcagcgatacccctgaagttcatcctccactgcccatttcccagtccccagaa
aatgagagtaatgataggagaagcagaaggtattcagtgtcggagagaagttttggatct
agaacgacgaaaaaattatcaactctacaaagtgccccccagcagcagacctcctcgtct
ccacctccacctctgctgactccaccgccaccactgcagccagcctccagtatctctgac
cacacaccttggcttatgcctccaacaatccccttagcatcaccatttttgcctgcttcc
actgctcctatgcaagggaagcgaaaatctattttgcgagaaccgacatttaggtggact
tctttaaagcattctaggtcagagccacaatacttttcctcagcaaagtatgccaaagaa
ggtcttattcgcaaaccaatatttgataatttccgaccccctccgctaactcccgaggac
gttggctttgcatctggtttttctgcatctggtaccgctgcttcagcccgattgttttcg
ccactccattctggaacaaggtttgatatgcacaaaaggagccctcttctgagagctcca
agatttactccaagtgaggctcactctagaatatttgagtctgtaaccttgcctagtaat
cgaacttctgctggaacatcttcttcaggagtatccaatagaaaaaggaaaagaaaagtg
tttagtcctattcgatctgaaccaagatctccttctcactccatgaggacaagaagtgga
aggcttagtacttctgagctgtcacctctcacccccccgtcttctgtctcttcctcgtta
agcatttctgttagtcctcttgccactagtgccttaaacccaactttcacttttccttct
cattccctgactcaatctggggaatctgcagagaaaaatcagagaccaaggaagcagact
agtgctccggcagagccattttcatcaagtagtcctactcctctcttcccttggtttacc
ccaggctctcagactgaaagagggagaaataaagacaaggtccccgaggagctgtccaaa
gatcgagatgctgacaagagcgtggagaaggacaagagtagagagagagaccgggagaga
gaaaaggagaataagcgggagtcaaggaaagagaaaaggaaaaagggatcagaaattcag
agtagttctgctttgtatcctgtgggtagggtttccaaagagaaggttgttggtgaagat
gttgccacttcatcttctgccaaaaaagcaacagggcggaagaagtcttcatcacatgat
tctgggactgatattacttctgtgactcttggggatacaacagctgtcaaaaccaaaata
cttataaagaaagggagaggaaatctggaaaaaaccaacttggacctcggcccaactgcc
ccatccctggagaaggagaaaaccctctgcctttccactccttcatctagcactgttaaa
cattccacttcctccataggctccatgttggctcaggcagacaagcttccaatgactgac
aagagggttgccagcctcctaaaaaaggccaaagctcagctctgcaagattgagaagagt
aagagtcttaaacaaactgaccagcccaaagcacagggtcaagaaagtgactcatcagag
acctctgtgcgaggaccccggattaaacatgtctgcagaagagcagctgttgcccttggc
cgaaaacgagctgtgtttcctgatgacatgcccaccctgagtgccttaccatgggaagaa
cgagaaaagattttgtcttccatggggaatgatgacaagtcatcaattgctggctcagaa
gatgctgaacctcttgctccacccatcaaaccaattaaacctgtcactagaaacaaggca
ccccaggaacctccagtaaagaaaggacgtcgatcgaggcggtgtgggcagtgtcccggc
tgccaggtgcctgaggactgtggtgtttgtactaattgcttagataagcccaagtttggt
ggtcgcaatataaagaagcagtgctgcaagatgagaaaatgtcagaatctacaatggatg
ccttccaaagcctacctgcagaagcaagctaaagctgtgaaaaagaaagagaaaaagtct
aagaccagtgaaaagaaagacagcaaagagagcagtgttgtgaagaacgtggtggactct
agtcagaaacctaccccatcagcaagagaggatcctgccccaaagaaaagcagtagtgag
cctcctccacgaaagcccgtcgaggaaaagagtgaagaagggaatgtctcggcccctggg
cctgaatccaaacaggccaccactccagcttccaggaagtcaagcaagcaggtctcccag
ccagcactggtcatcccccctcagccacctactacaggaccgccaaggaaagaacttccc
aaaaccactcctagtgagcccaagaaaaagcagcctccaccaccagaatcaggtccagag
cagagcaaacagaaaaaagtggctccccgcccaagtatccctgtaaaacaaaaaccaaaa
gaaaagcagctgctggagtgtaataagtgccgaaacagctatcaccctgagtgcctggga
ccaaactaccccaccaaacccacaaagaagaagaaagtctggatctgtaccaagtgtgtt
cgctgtaagagctgtggatccacaactccaggcaaagggtgggatgcacagtggtctcac
gatttctcactgtgtcatgattgcgccaagctctttgctaaaggaaacttctgccctctc
tgtgacaaatgttatgatgatgatgactatgagagtaagatgatgcaatgtggaaagtgt
gatcgctgggtccattccaaatgtgagaatctttcagatgagatgtatgagattctatct
aatctgccagaaagtgtggcctacacttgtgtgaactgtactgagcggcaccctgcagag
tggcgactggcccttgaaaaagagctacagatttctctgaagcaagttctgacagctttg
ttgaattctcggactaccagccatttgctacgctaccggcaggctgccaagcctccagac
ttaaatcccgagacagaggagagtataccttcccgcagctcccccgaaggacctgatcca
ccagttcttactgaggtcagcaaacaggatgatcagcagcctttagatctagaaggagtc
aagaggaagatggaccaagggaattacacatctgtgttggagttcagtgatgatattgtg
aagatcattcaagcagccattaattcagatggaggacagccagaaattaaaaaagccaac
agcatggtcaagtccttcttcattcggcaaatggaacgtgtttttccatggttcagtgtc
aaaaagtccaggttttgggagccaaataaagtatcaagcaacagcgggatgttaccaaac
gcagtgcttccaccttcacttgaccataattatgctcagtggcaggagcgagaggaaaac
agccacactgagcagcctcctttaatgaagaaaatcattccagctcccaaacccaaaggt
cctggagaaccagactcaccaactcctctgcatcctcctacaccaccaattttgagtact
gataggagtcgagaagacagtccagagctgaacccacccccaggcatagaagacaataga
cagtgtgcgttatgtttgacttatggtgatgacagtgctaatgatgctggtcgtttacta
tatattggccaaaatgagtggacacatgtaaattgtgctttgtggtcagcggaagtgttt
gaagatgatgacggatcactaaagaatgtgcatatggctgtgatcaggggcaagcagctg
agatgtgaattctgccaaaagccaggagccaccgtgggttgctgtctcacatcctgcacc
agcaactatcacttcatgtgttcccgagccaagaactgtgtctttctggatgataaaaaa
gtatattgccaacgacatcgggatttgatcaaaggcgaagtggttcctgagaatggattt
gaagttttcagaagagtgtttgtggactttgaaggaatcagcttgagaaggaagtttctc
aatggcttggaaccagaaaatatccacatgatgattgggtctatgacaatcgactgctta
ggaattctaaatgatctctccgactgtgaagataagctctttcctattggatatcagtgt
tccagggtatactggagcaccacagatgctcgcaagcgctgtgtatatacatgcaagata
gtggagtgccgtcctccagtcgtagagccggatatcaacagcactgttgaacatgatgaa
aacaggaccattgcccatagtccaacatcttttacagaaagttcatcaaaagagagtcaa
aacacagctgaaattataagtcctccatcaccagaccgacctcctcattcacaaacctct
ggctcctgttattatcatgtcatctcaaaggtccccaggattcgaacacccagttattct
ccaacacagagatcccctggctgtcgaccgttgccttctgcaggaagtcctaccccaacc
actcacgaaatagtcacagtaggtgatcctttactctcctctggacttcgaagcattggc
tccaggcgtcacagtacctcttccttatcaccccagcggtccaaactccggataatgtct
ccaatgagaactgggaatacttactctaggaataatgtttcctcagtctccaccattggg
accgctactgatcttgaatcaagtgccaaagtagttgatcatgtcttagggccactgaat
tcaagtactagtttagggcaaaacacttccacctcttcaaatttgcaaaggacagtggtt
actgtaggcaataaaaacagtcacttggatggatcttcatcttcagaaatgaagcagtcc
agtgcttcagacttggcgtccaagagctcctctttaaagggagagaagaccaaagtgctg
agttccaagagctcagagggatctgcacataatgtggcttaccctggaattcctaaactg
gccccacaggttcataacacaacatctagagaactgaatgttagtaaaatcggctccttt
gctgaaccctcttcagtgtcgttttcttctaaagaggccctctccttcccacacctccat
ttgagagggcaaaggaatgatcgagaccaacacacagattctacccaatcagcaaactcc
tctccagatgaagatactgaagtcaaaaccttgaagctatctggaatgagcaacagatca
tccattatcaatgaacatatgggatctagttccagagataggagacagaaagggaaaaaa
tcttgtaaagaaactttcaaagaaaagcattccagtaaatcttttttggaacctggtcag
gtgacaactggtgaggaaggaaacttgaagccagagtttatggatgaggttttgactcct
gagtatatgggccaacgaccatgtaacaatgtttcttctgataagattggtgataaaggc
ctttctatgccaggagtccccaaagctccacccatgcaagtagaaggatctgccaaggaa
ttacaggcaccacggaaacgcacagtcaaagtgacactgacacctctaaaaatggaaaat
gagagtcaatccaaaaacgccctgaaagaaagtagtcctgcttcccctttgcaaatagag
tcaacatctcccacagaaccaatttcagcctctgaaaatccaggagatggtccagtggcc
caaccaagccccaataatacctcatgccaggattctcaaagtgacaactatcagaatctt
ccagtacaggacagaaacctaatgcttccagatggccccaaacctcaggaggatggctct
tttaaaaggaggtatccccgtcgcagtgcccgtgcacgttctaacatgttttttgggctt
accccactctatggagtaagatcctatggtgaagaagacattccattctacagcagctca
actgggaagaagcgaggcaagagatcagctgaaggacaggtggatggggccgatgactta
agcacttcagatgaagacgacttatactattacaacttcactagaacagtgatttcttca
ggtggagaggaacgactggcatcccataatttatttcgggaggaggaacagtgtgatctt
ccaaaaatctcacagttggatggtgttgatgatgggacagagagtgatactagtgtcaca
gccacaacaaggaaaagcagccaggttccaaaaagaaatggtaaagaaaatggaacagag
aacttaaagattgatcgacctgaagatgctggggagaaagaacatgtcactaagagttct
gttggccacaaaaatgagccaaagatggataactgccattctgtaagcagagttaaaaca
cagggacaggattccttggaagctcagctcagctcattggagtcaagccgcagagtccac
acaagtaccccctccgacaaaaatttactggacacctataatactgagctcctgaaatca
gattcagacaataacaacagtgatgactgtgggaatatcctgccttcagacattatggac
tttgtactaaagaatactccatccatgcaggctttgggtgaaagcccagagtcatcttca
tcagaactcctgaatcttggtgaaggattgggtcttgacagtaatcgtgaaaaagacatg
ggtctttttgaagtattttctcagcagctgcctacaacagaacctgtggatagtagtgtc
tcttcctctatctcagcagaggaacagtttgagttgcctctagagctaccatctgatctg
tctgtcttgaccacccggagtcccactgtccccagccagaatcccagtagactagctgtt
atctcagattcaggggagaagagagtaaccatcacagaaaaatctgtagcctcctctgaa
ggtgacccagcactgctgagcccaggagtagatccaactcctgaaggccacatgactccc
gatcattttatccaaggacacatggatgcagaccacatctctagccctccttgtggttca
gtagagcaaggtcatggcaacaatcaggatttaactaggaacagtagcacccctggcctt
caggtacctgtttccccaactgttcccatccagaaccagaagtatgtgcccaattctact
gatagtcctggcccgtctcagatttccaatgcagctgtccagaccactccaccccacctg
aagccagccactgagaaactcatagttgttaaccagaacatgcagccactttatgttctc
caaactcttccaaatggagtgacccaaaaaatccaattgacctcttccgttagttctaca
cccagtgtgatggagacaaatacttcagtattgggacccatgggaagtggtctcaccctt
accacaggactaaatccaagcttgccaacttctcaatctttgttcccttctgctagcaaa
ggattgctacccatgtctcatcaccagcacttacattccttccctgcagctactcaaagt
agtttcccaccgaacatcagcaatcctccttcaggcctgcttattggggttcagcctcct
ccggatccccaacttttggtttcagaatccagccagaggacagacctcagtaccacagta
gccactccatcctctggactcaagaaaagacccatatctcgtctacagacccgaaagaat
aaaaaacttgctccctctagtaccccttcaaacattgccccttctgatgtggtttctaat
atgacattgattaacttcacaccctcccagcttcctaatcatcccagtctgttagatttg
gggtcacttaatacttcatctcaccgaactgtccccaacatcataaaaagatctaaatct
agtatcatgtattttgaaccggcacccctgttaccacagagtgtgggaggaactgctgcc
acagcggcaggcacatcaacaataagccaggatactagccacctcacatcagggtctgtg
tctggcttggcatccagttcctctgtcttgaatgttgtatccatgcaaactaccacaacc
cctacaagtagtgcatcagttccaggacacgtcaccttaaccaacccaaggttgcttggt
accccagatattggctcaataagcaatcttttaatcaaagctagccagcagagcctgggg
attcaggatcagcctgtggctttaccgccaagttcaggaatgtttccacaactggggaca
tcacagaccccctctactgctgcaatgacagcggcatctagcatctgtgtgctcccctcc
acccagactacgggcataacagccgcttcaccttctggggaagcagacgaacactatcag
cttcagcatgtgaaccagctccttgccagcaaaactgggattcattcttcccagcgtgat
cttgattctgcttcagggccccaggtatccaactttacccagacggtagacgctcctaat
agcatgggactggagcagaacaaggctttatcctcagctgtgcaagccagccccacctct
cctgggggttctccatcctctccatcttctggacagcggtcagcaagcccttcagtgccg
ggtcccactaaacccaaaccaaaaaccaaacggtttcagctgcctctagacaaagggaat
ggcaagaagcacaaagtttcccatttgcggaccagttctgaagcacacattccagaccaa
gaaacaacatccctgacctcaggcacagggactccaggagcagaggctgagcagcaggat
acagctagtgtggagcagtcctcccagaaggagtgtgggcaaccttcagggcaagtggct
gttcttccggaagttcaggtgacccaaaatccagcaaatgaacaagaaagtacagaacct
aaaacagtggaagaagaagaaagtaatttcagctccccactgatgctttggcttcagcaa
gaacaaaagcggaaggaaagcattactgagaaaaaacccaagaaaggacttgtttttgaa
atttccagtgatgatggctttcagatctgtgcagaaagtattgaagatgcctggaagtca
ttgacagataaagtccaggaagctcgatcaaatgcccgcctaaagcagctctcatttgca
ggtgttaacggtttgaggatgctggggattctccatgatgcagttgtgttcctcattgag
cagctgtctggtgccaagcactgtcgaaattacaaattccgtttccacaagccagaggag
gccaatgaaccccccttgaaccctcatggctcagccagggctgaagtccacctcaggcaa
tcagcatttgacatgtttaactttctggcttctaaacatcgtcagcctcctgaatacaac
cccaatgatgaagaagaggaggaggtacagctgaagtcagctcggagggcaactagcatg
gatctgccaatgcctatgcgcttccggcacttaaaaaagacttctaaggaggcagttggt
gtctacaggtctcccatccatggccggggtcttttctgtaagagaaacattgatgcaggt
gagatggtgattgagtatgccggcaacgtcatccgctccatccagactgacaagcgggaa
aagtattacgacagcaagggcattggttgctatatgttccgaattgatgactcagaggta
gtggatgccaccatgcatggaaatgctgcacgcttcatcaatcactcgtgtgagcctaac
tgctattctcgggtcatcaatattgatgggcagaagcacattgtcatctttgccatgcgt
aagatctaccgaggagaggaactcacttacgactataagttccccattgaggatgccagc
aacaagctgccctgcaactgtggcgccaagaaatgccggaagttcctaaactaa

DBGET integrated database retrieval system