KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129366Help
Entry
101129366         CDS       T02442                                 

Gene name
KMT2A, MLL
Definition
(RefSeq) lysine methyltransferase 2A
  KO
K09186  
histone-lysine N-methyltransferase MLL1 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101129366 (KMT2A)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    101129366 (KMT2A)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101129366 (KMT2A)
Transcription factors [BR:ggo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101129366 (KMT2A)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101129366 (KMT2A)
   HMT complexes
    MLL-HCF complex
     101129366 (KMT2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
ENSGGOG00000000946
Position
11
AA seq 4004 aa AA seqDB search
MAHSCRWRFPARPGTTGGGGGGGRRGLGGAPRQRVPALLLPPGPPVGGGGPGAPPSPPAA
AAAAAAAGSSGAGVPGGAAAASAASSSSASSSSSSSSSASSGPALLRVGPGFDAALQVSA
AIGTNLRRFRAVFGESGGGGGSGELTTQIPCSWRTKGHIHDKKTEPFRLLAWSWCLNDEQ
FLGFGSDEEVRVRSPTRSPSVKTSPRKPRGRPRSGSDRNSAILSDPSVFSPLNKSETKSG
DKIKKKDSKSIEKKRGRPPTFPGVKIKITHGKDISELPKGNKEDSLKKIKRTPSATFQQA
TKIKKLRAGKLSPLKSKFKTGKLQIGRKGVQIVRRRGRPPSTERIKTPSGLLINSELEKP
QKVRKDKEGTPPLTKEDKTVVRQSPRRIKPVRIIPSSKRTDATIAKQLLQRAKKGAQKKI
EKEAAQLQGRKVKTQVKNIRQFIMPVVSAISSRIIKTPRRFIEDEDYDPPIKIARLESTP
NSRFSAPSCGSSEKSSAASQHSSQMSSDSSRSSSPSVDTSTDSQASEEIQVLPEERSDTP
EVHPPLPISQSPENESNDRRSRRYSVSERSFGSRTTKKLSTLQSAPQQQTSSSPPPPLLT
PPPPLQPASSISDHTPWLMPPTIPLASPFLPASTAPMQGKRKSILREPTFRWTSLKHSRS
EPQYFSSAKYAKEGLIRKPIFDNFRPPPLTPEDVGFASGFSASGTAASARLFSPLHSGTR
FDMHKRSPLLRAPRFTPSEAHSRIFESVTLPSNRTSAGTSSSGVSNRKRKRKVFSPIRSE
PRSPSHSMRTRSGRLSTSELSPLTPPSSVSSSLSISVSPLATSALNPTFTFPSHSLTQSG
ESAEKNQRPRKQTSAPAEPFSSSSPTPLFPWFTPGSQTERGRNKDKVPEELSKDRDADKS
VEKDKSRERDREREKENKRESRKEKRKKGSEIQSSSALYPVGRVSKEKVVGEDVATSSSA
KKATGRKKSSSHDSGTDITSVTLGDTTAVKTKILIKKGRGNLEKTNLDLGPTAPSLEKEK
TLCLSTPSSSTVKHSTSSIGSMLAQADKLPMTDKRVASLLKKAKAQLCKIEKSKSLKQTD
QPKAQGQESDSSETSVRGPRIKHVCRRAAVALGRKRAVFPDDMPTLSALPWEEREKILSS
MGNDDKSSIAGSEDAEPLAPPIKPIKPVTRNKAPQEPPVKKGRRSRRCGQCPGCQVPEDC
GVCTNCLDKPKFGGRNIKKQCCKMRKCQNLQWMPSKAYLQKQAKAVKKKEKKSKTSEKKD
SKESSVVKNVVDSSQKPTPSAREDPAPKKSSSEPPPRKPVEEKSEEGNVSAPGPESKQAT
TPASRKSSKQVSQPALVIPPQPPTTGPPRKELPKTTPSEPKKKQPPPPESGPEQSKQKKV
APRPSIPVKQKPKEKEKPPPVNKQENAGTLNILSTLSNGNSSKQKIPADGVHRIRVDFKE
DCEAENVWEMGGLGILTSVPITPRVVCFLCASSGHVEFVYCQVCCEPFHKFCLEENERPL
EDQLENWCCRRCKFCHVCGRQHQATKQLLECNKCRNSYHPECLGPNYPTKPTKKKKVWIC
TKCVRCKSCGSTTPGKGWDAQWSHDFSLCHDCAKLFAKGNFCPLCDKCYDDDDYESKMMQ
CGKCDRWVHSKCENLSGTEDEMYEILSNLPESVAYTCVNCTERHPAEWRLALEKELQISL
KQVLTALLNSRTTSHLLRYRQAAKPPDLNPETEESIPSRSSPEGPDPPVLTEVSKQDDQQ
PLDLEGVKRKMDQGNYTSVLEFSDDIVKIIQAAINSDGGQPEIKKANSMVKSFFIRQMER
VFPWFSVKKSRFWEPNKVSSNSGMLPNAVLPPSLDHNYAQWQEREENSHTEQPPLMKKII
PAPKPKGPGEPDSPTPLHPPTPPILSTDRSREDSPELNPPPGIEDNRQCALCLTYGDDSA
NDAGRLLYIGQNEWTHVNCALWSAEVFEDDDGSLKNVHMAVIRGKQLRCEFCQKPGATVG
CCLTSCTSNYHFMCSRAKNCVFLDDKKVYCQRHRDLIKGEVVPENGFEVFRRVFVDFEGI
SLRRKFLNGLEPENIHMMIGSMTIDCLGILNDLSDCEDKLFPIGYQCSRVYWSTTDARKR
CVYTCKIVECRPPVVEPDINSTVEHDENRTIAHSPTSFTESSSKESQNTAEIISPPSPDR
PPHSQTSGSCYYHVISKVPRIRTPSYSPTQRSPGCRPLPSAGSPTPTTHEIVTVGDPLLS
SGLRSIGSRRHSTSSLSPQRSKLRIMSPMRTGNTYSRNNVSSVSTIGTATDLESSAKVVD
HVLGPLNSSTSLGQNTSTSSNLQRTVVTVGNKNSHLDGSSSSEMKQSSASDLASKSSSLK
GEKTKVLSSKSSEGSAHNVAYPGIPKLAPQVHNTTSRELNVSKIGSFAEPSSVSFSSKEA
LSFPHLHLRGQRNDRDQHTDSTQSANSSPDEDTEVKTLKLSGMSNRSSIINEHMGSSSRD
RRQKGKKSCKETFKEKHSSKSFLEPGQVTTGEEGNLKPEFMDEVLTPEYMGQRPCNNVSS
DKIGDKGLSMPGVPKAPPMQVEGSAKELQAPRKRTVKVTLTPLKMENESQSKNALKESSP
ASPLQIESTSPTEPISASENPGDGPVAQPSPNNTSCQDSQSDNYQNLPVQDRNLMLPDGP
KPQEDGSFKRRYPRRSARARSNMFFGLTPLYGVRSYGEEDIPFYSSSTGKKRGKRSAEGQ
VDGADDLSTSDEDDLYYYNFTRTVISSGGEERLASHNLFREEEQCDLPKISQLDGVDDGT
ESDTSVTATTRKSSQVPKRNGKENGTENLKIDRPEDAGEKEHVTKSSVGHKNEPKMDNCH
SVSRVKTQGQDSLEAQLSSLESSRRVHTSTPSDKNLLDTYNTELLKSDSDNNNSDDCGNI
LPSDIMDFVLKNTPSMQALGESPESSSSELLNLGEGLGLDSNREKDMGLFEVFSQQLPTT
EPVDSSVSSSISAEEQFELPLELPSDLSVLTTRSPTVPSQNPSRLAVISDSGEKRVTITE
KSVASSEGDPALLSPGVDPTPEGHMTPDHFIQGHMDADHISSPPCGSVEQGHGNNQDLTR
NSSTPGLQVPVSPTVPIQNQKYVPNSTDSPGPSQISNAAVQTTPPHLKPATEKLIVVNQN
MQPLYVLQTLPNGVTQKIQLTSSVSSTPSVMETNTSVLGPMGSGLTLTTGLNPSLPTSQS
LFPSASKGLLPMSHHQHLHSFPAATQSSFPPNISNPPSGLLIGVQPPPDPQLLVSESSQR
TDLSTTVATPSSGLKKRPISRLQTRKNKKLAPSSTPSNIAPSDVVSNMTLINFTPSQLPN
HPSLLDLGSLNTSSHRTVPNIIKRSKSSIMYFEPAPLLPQSVGGTAATAAGTSTISQDTS
HLTSGSVSGLASSSSVLNVVSMQTTTTPTSSASVPGHVTLTNPRLLGTPDIGSISNLLIK
ASQQSLGIQDQPVALPPSSGMFPQLGTSQTPSTAAMTAASSICVLPSTQTTGITAASPSG
EADEHYQLQHVNQLLASKTGIHSSQRDLDSASGPQVSNFTQTVDAPNSMGLEQNKALSSA
VQASPTSPGGSPSSPSSGQRSASPSVPGPTKPKPKTKRFQLPLDKGNGKKHKVSHLRTSS
EAHIPDQETTSLTSGTGTPGAEAEQQDTASVEQSSQKECGQPSGQVAVLPEVQVTQNPAN
EQESTEPKTVEEEESNFSSPLMLWLQQEQKRKESITEKKPKKGLVFEISSDDGFQICAES
IEDAWKSLTDKVQEARSNARLKQLSFAGVNGLRMLGILHDAVVFLIEQLSGAKHCRNYKF
RFHKPEEANEPPLNPHGSARAEVHLRKSAFDMFNFLASKHRQPPEYNPNDEEEEEVQLKS
ARRATSMDLPMPMRFRHLKKTSKEAVGVYRSPIHGRGLFCKRNIDAGEMVIEYAGNVIRS
IQTDKREKYYDSKGIGCYMFRIDDSEVVDATMHGNAARFINHSCEPNCYSRVINIDGQKH
IVIFAMRKIYRGEELTYDYKFPIEDASNKLPCNCGAKKCRKFLN
NT seq 12015 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacagctgtcggtggcgcttccccgcccgacccgggaccaccgggggcggcggc
ggcggggggcggcggggcctcgggggcgccccgcggcaacgcgtcccggccctgctgctt
ccccccgggcccccggtcggcggtggcggccccggggcgcccccctcccccccggctgcg
gcggccgcggcggcggcggcgggaagcagcggggctggggttccagggggagcggccgcc
gcctcagcagcctcctcgtcgtccgcctcgtcttcgtcttcgtcatcgtcctcagcctct
tcagggccggccctgctccgggtgggcccgggcttcgacgcggcgctgcaggtctcggcc
gccatcggcaccaacctgcgccggttccgggccgtgtttggggagagcggcgggggaggc
ggcagcggagagctaacaacacagatcccatgtagttggagaaccaaaggccacatacat
gacaaaaagactgaaccgttcaggttacttgcatggagttggtgcttaaatgatgagcaa
ttcttaggttttggctcagatgaagaagtcagagtgcgaagtcccacaaggtctccttca
gttaaaactagtcctcgaaaacctcgtgggagacctagaagtggctctgaccgaaattca
gctatcctctcagatccatctgtgttttcccctctaaataaatcagagaccaaatctgga
gataagatcaagaagaaagattctaaaagtatagaaaagaagagaggaagacctcccacc
ttccctggagtaaaaatcaaaataacacatggaaaggacatttcagagttaccaaaggga
aacaaagaagatagcctgaaaaaaattaaaaggacaccttctgctacgtttcagcaagcc
acaaagattaaaaaattaagagcaggtaaactctctcctctcaagtctaagtttaagaca
gggaagcttcaaataggaaggaagggggtacaaattgtacgacggagaggaaggcctcca
tcaacagaaaggataaagaccccttcgggtctcctcattaattctgaactggaaaagccc
cagaaagtccggaaagacaaggaaggaacacctccacttacaaaagaagataagacagtt
gtcagacaaagccctcgaaggattaagccagttaggattattccttcttcaaaaaggaca
gatgcaaccattgctaagcaactcttacagagggcaaaaaagggggctcaaaagaaaatt
gaaaaagaagcagctcagctgcagggaagaaaggtgaagacacaggtcaaaaatattcga
cagttcatcatgcctgttgtcagtgctatctcctcgcggatcattaagacccctcggcgg
tttatagaggatgaggattatgaccctccaattaaaattgcccgattagagtctacaccg
aatagtagattcagtgccccgtcctgtggatcttctgaaaaatcaagtgcagcttctcag
cactcctctcaaatgtcttcagactcctctcgatctagtagccccagtgttgatacctcc
acagactctcaggcttctgaggagattcaggtacttcctgaggagcgcagcgatacccct
gaagttcatcctccactgcccatttcccagtccccagaaaatgagagtaatgataggaga
agcagaaggtattcagtgtcggagagaagttttggatctagaacgacgaaaaaattatca
actctacaaagtgccccccagcagcagacctcctcgtctccacctccacctctgctgact
ccaccgccaccactgcagccagcctccagtatctctgaccacacaccttggcttatgcct
ccaacaatccccttagcatcaccatttttgcctgcttccactgctcctatgcaagggaag
cgaaaatctattttgcgagaaccgacatttaggtggacttctttaaagcattctaggtca
gagccacaatacttttcctcagcaaagtatgccaaagaaggtcttattcgcaaaccaata
tttgataatttccgaccccctccgctaactcccgaggacgttggctttgcatctggtttt
tctgcatctggtaccgctgcttcagcccgattgttttcgccactccattctggaacaagg
tttgatatgcacaaaaggagccctcttctgagagctccaagatttactccaagtgaggct
cactctagaatatttgagtctgtaaccttgcctagtaatcgaacttctgctggaacatct
tcttcaggagtatccaatagaaaaaggaaaagaaaagtgtttagtcctattcgatctgaa
ccaagatctccttctcactccatgaggacaagaagtggaaggcttagtacttctgagctg
tcacctctcacccccccgtcttctgtctcttcctcgttaagcatttctgttagtcctctt
gccactagtgccttaaacccaactttcacttttccttctcattccctgactcaatctggg
gaatctgcagagaaaaatcagagaccaaggaagcagactagtgctccggcagagccattt
tcatcaagtagtcctactcctctcttcccttggtttaccccaggctctcagactgaaaga
gggagaaataaagacaaggtccccgaggagctgtccaaagatcgagatgctgacaagagc
gtggagaaggacaagagtagagagagagaccgggagagagaaaaggagaataagcgggag
tcaaggaaagagaaaaggaaaaagggatcagaaattcagagtagttctgctttgtatcct
gtgggtagggtttccaaagagaaggttgttggtgaagatgttgccacttcatcttctgcc
aaaaaagcaacagggcggaagaagtcttcatcacatgattctgggactgatattacttct
gtgactcttggggatacaacagctgtcaaaaccaaaatacttataaagaaagggagagga
aatctggaaaaaaccaacttggacctcggcccaactgccccatccctggagaaggagaaa
accctctgcctttccactccttcatctagcactgttaaacattccacttcctccataggc
tccatgttggctcaggcagacaagcttccaatgactgacaagagggttgccagcctccta
aaaaaggccaaagctcagctctgcaagattgagaagagtaagagtcttaaacaaactgac
cagcccaaagcacagggtcaagaaagtgactcatcagagacctctgtgcgaggaccccgg
attaaacatgtctgcagaagagcagctgttgcccttggccgaaaacgagctgtgtttcct
gatgacatgcccaccctgagtgccttaccatgggaagaacgagaaaagattttgtcttcc
atggggaatgatgacaagtcatcaattgctggctcagaagatgctgaacctcttgctcca
cccatcaaaccaattaaacctgtcactagaaacaaggcaccccaggaacctccagtaaag
aaaggacgtcgatcgaggcggtgtgggcagtgtcccggctgccaggtgcctgaggactgt
ggtgtttgtactaattgcttagataagcccaagtttggtggtcgcaatataaagaagcag
tgctgcaagatgagaaaatgtcagaatctacaatggatgccttccaaagcctacctgcag
aagcaagctaaagctgtgaaaaagaaagagaaaaagtctaagaccagtgaaaagaaagac
agcaaagagagcagtgttgtgaagaacgtggtggactctagtcagaaacctaccccatca
gcaagagaggatcctgccccaaagaaaagcagtagtgagcctcctccacgaaagcccgtc
gaggaaaagagtgaagaagggaatgtctcggcccctgggcctgaatccaaacaggccacc
actccagcttccaggaagtcaagcaagcaggtctcccagccagcactggtcatcccccct
cagccacctactacaggaccgccaaggaaagaacttcccaaaaccactcctagtgagccc
aagaaaaagcagcctccaccaccagaatcaggtccagagcagagcaaacagaaaaaagtg
gctccccgcccaagtatccctgtaaaacaaaaaccaaaagaaaaggaaaaaccacctccg
gtcaataagcaggagaatgcaggcactttgaacatcctcagcactctctccaatggcaat
agttctaagcaaaaaattccagcagatggagtccacaggatcagagtggactttaaggag
gattgtgaagcagaaaatgtgtgggagatgggaggcttaggaatcttgacttctgttcct
ataacacccagggtggtttgctttctctgtgccagtagtgggcatgtagagtttgtgtat
tgccaagtctgttgtgagcccttccacaagttttgtttagaggagaacgagcgccctctg
gaggaccagctggaaaattggtgttgtcgtcgctgcaaattctgtcacgtttgtggaagg
caacatcaggctacaaagcagctgctggagtgtaataagtgccgaaacagctatcaccct
gagtgcctgggaccaaactaccccaccaaacccacaaagaagaagaaagtctggatctgt
accaagtgtgttcgctgtaagagctgtggatccacaactccaggcaaagggtgggatgca
cagtggtctcacgatttctcactgtgtcatgattgcgccaagctctttgctaaaggaaac
ttctgccctctctgtgacaaatgttatgatgatgatgactatgagagtaagatgatgcaa
tgtggaaagtgtgatcgctgggtccattccaaatgtgagaatctttcaggtacagaagat
gagatgtatgagattctatctaatctgccagaaagtgtggcctacacttgtgtgaactgt
actgagcggcaccctgcagagtggcgactggcccttgaaaaagagctacagatttctctg
aagcaagttctgacagctttgttgaattctcggactaccagccatttgctacgctaccgg
caggctgccaagcctccagacttaaatcccgagacagaggagagtataccttcccgcagc
tcccccgaaggacctgatccaccagttcttactgaggtcagcaaacaggatgatcagcag
cctttagatctagaaggagtcaagaggaagatggaccaagggaattacacatctgtgttg
gagttcagtgatgatattgtgaagatcattcaagcagccattaattcagatggaggacag
ccagaaattaaaaaagccaacagcatggtcaagtccttcttcattcggcaaatggaacgt
gtttttccatggttcagtgtcaaaaagtccaggttttgggagccaaataaagtatcaagc
aacagcgggatgttaccaaacgcagtgcttccaccttcacttgaccataattatgctcag
tggcaggagcgagaggaaaacagccacactgagcagcctcctttaatgaagaaaatcatt
ccagctcccaaacccaaaggtcctggagaaccagactcaccaactcctctgcatcctcct
acaccaccaattttgagtactgataggagtcgagaagacagtccagagctgaacccaccc
ccaggcatagaagacaatagacagtgtgcgttatgtttgacttatggtgatgacagtgct
aatgatgctggtcgtttactatatattggccaaaatgagtggacacatgtaaattgtgct
ttgtggtcagcggaagtgtttgaagatgatgacggatcactaaagaatgtgcatatggct
gtgatcaggggcaagcagctgagatgtgaattctgccaaaagccaggagccaccgtgggt
tgctgtctcacatcctgcaccagcaactatcacttcatgtgttcccgagccaagaactgt
gtctttctggatgataaaaaagtatattgccaacgacatcgggatttgatcaaaggcgaa
gtggttcctgagaatggatttgaagttttcagaagagtgtttgtggactttgaaggaatc
agcttgagaaggaagtttctcaatggcttggaaccagaaaatatccacatgatgattggg
tctatgacaatcgactgcttaggaattctaaatgatctctccgactgtgaagataagctc
tttcctattggatatcagtgttccagggtatactggagcaccacagatgctcgcaagcgc
tgtgtatatacatgcaagatagtggagtgccgtcctccagtcgtagagccggatatcaac
agcactgttgaacatgatgaaaacaggaccattgcccatagtccaacatcttttacagaa
agttcatcaaaagagagtcaaaacacagctgaaattataagtcctccatcaccagaccga
cctcctcattcacaaacctctggctcctgttattatcatgtcatctcaaaggtccccagg
attcgaacacccagttattctccaacacagagatcccctggctgtcgaccgttgccttct
gcaggaagtcctaccccaaccactcacgaaatagtcacagtaggtgatcctttactctcc
tctggacttcgaagcattggctccaggcgtcacagtacctcttccttatcaccccagcgg
tccaaactccggataatgtctccaatgagaactgggaatacttactctaggaataatgtt
tcctcagtctccaccattgggaccgctactgatcttgaatcaagtgccaaagtagttgat
catgtcttagggccactgaattcaagtactagtttagggcaaaacacttccacctcttca
aatttgcaaaggacagtggttactgtaggcaataaaaacagtcacttggatggatcttca
tcttcagaaatgaagcagtccagtgcttcagacttggcgtccaagagctcctctttaaag
ggagagaagaccaaagtgctgagttccaagagctcagagggatctgcacataatgtggct
taccctggaattcctaaactggccccacaggttcataacacaacatctagagaactgaat
gttagtaaaatcggctcctttgctgaaccctcttcagtgtcgttttcttctaaagaggcc
ctctccttcccacacctccatttgagagggcaaaggaatgatcgagaccaacacacagat
tctacccaatcagcaaactcctctccagatgaagatactgaagtcaaaaccttgaagcta
tctggaatgagcaacagatcatccattatcaatgaacatatgggatctagttccagagat
aggagacagaaagggaaaaaatcttgtaaagaaactttcaaagaaaagcattccagtaaa
tcttttttggaacctggtcaggtgacaactggtgaggaaggaaacttgaagccagagttt
atggatgaggttttgactcctgagtatatgggccaacgaccatgtaacaatgtttcttct
gataagattggtgataaaggcctttctatgccaggagtccccaaagctccacccatgcaa
gtagaaggatctgccaaggaattacaggcaccacggaaacgcacagtcaaagtgacactg
acacctctaaaaatggaaaatgagagtcaatccaaaaacgccctgaaagaaagtagtcct
gcttcccctttgcaaatagagtcaacatctcccacagaaccaatttcagcctctgaaaat
ccaggagatggtccagtggcccaaccaagccccaataatacctcatgccaggattctcaa
agtgacaactatcagaatcttccagtacaggacagaaacctaatgcttccagatggcccc
aaacctcaggaggatggctcttttaaaaggaggtatccccgtcgcagtgcccgtgcacgt
tctaacatgttttttgggcttaccccactctatggagtaagatcctatggtgaagaagac
attccattctacagcagctcaactgggaagaagcgaggcaagagatcagctgaaggacag
gtggatggggccgatgacttaagcacttcagatgaagacgacttatactattacaacttc
actagaacagtgatttcttcaggtggagaggaacgactggcatcccataatttatttcgg
gaggaggaacagtgtgatcttccaaaaatctcacagttggatggtgttgatgatgggaca
gagagtgatactagtgtcacagccacaacaaggaaaagcagccaggttccaaaaagaaat
ggtaaagaaaatggaacagagaacttaaagattgatcgacctgaagatgctggggagaaa
gaacatgtcactaagagttctgttggccacaaaaatgagccaaagatggataactgccat
tctgtaagcagagttaaaacacagggacaggattccttggaagctcagctcagctcattg
gagtcaagccgcagagtccacacaagtaccccctccgacaaaaatttactggacacctat
aatactgagctcctgaaatcagattcagacaataacaacagtgatgactgtgggaatatc
ctgccttcagacattatggactttgtactaaagaatactccatccatgcaggctttgggt
gaaagcccagagtcatcttcatcagaactcctgaatcttggtgaaggattgggtcttgac
agtaatcgtgaaaaagacatgggtctttttgaagtattttctcagcagctgcctacaaca
gaacctgtggatagtagtgtctcttcctctatctcagcagaggaacagtttgagttgcct
ctagagctaccatctgatctgtctgtcttgaccacccggagtcccactgtccccagccag
aatcccagtagactagctgttatctcagattcaggggagaagagagtaaccatcacagaa
aaatctgtagcctcctctgaaggtgacccagcactgctgagcccaggagtagatccaact
cctgaaggccacatgactcccgatcattttatccaaggacacatggatgcagaccacatc
tctagccctccttgtggttcagtagagcaaggtcatggcaacaatcaggatttaactagg
aacagtagcacccctggccttcaggtacctgtttccccaactgttcccatccagaaccag
aagtatgtgcccaattctactgatagtcctggcccgtctcagatttccaatgcagctgtc
cagaccactccaccccacctgaagccagccactgagaaactcatagttgttaaccagaac
atgcagccactttatgttctccaaactcttccaaatggagtgacccaaaaaatccaattg
acctcttccgttagttctacacccagtgtgatggagacaaatacttcagtattgggaccc
atgggaagtggtctcacccttaccacaggactaaatccaagcttgccaacttctcaatct
ttgttcccttctgctagcaaaggattgctacccatgtctcatcaccagcacttacattcc
ttccctgcagctactcaaagtagtttcccaccgaacatcagcaatcctccttcaggcctg
cttattggggttcagcctcctccggatccccaacttttggtttcagaatccagccagagg
acagacctcagtaccacagtagccactccatcctctggactcaagaaaagacccatatct
cgtctacagacccgaaagaataaaaaacttgctccctctagtaccccttcaaacattgcc
ccttctgatgtggtttctaatatgacattgattaacttcacaccctcccagcttcctaat
catcccagtctgttagatttggggtcacttaatacttcatctcaccgaactgtccccaac
atcataaaaagatctaaatctagtatcatgtattttgaaccggcacccctgttaccacag
agtgtgggaggaactgctgccacagcggcaggcacatcaacaataagccaggatactagc
cacctcacatcagggtctgtgtctggcttggcatccagttcctctgtcttgaatgttgta
tccatgcaaactaccacaacccctacaagtagtgcatcagttccaggacacgtcacctta
accaacccaaggttgcttggtaccccagatattggctcaataagcaatcttttaatcaaa
gctagccagcagagcctggggattcaggatcagcctgtggctttaccgccaagttcagga
atgtttccacaactggggacatcacagaccccctctactgctgcaatgacagcggcatct
agcatctgtgtgctcccctccacccagactacgggcataacagccgcttcaccttctggg
gaagcagacgaacactatcagcttcagcatgtgaaccagctccttgccagcaaaactggg
attcattcttcccagcgtgatcttgattctgcttcagggccccaggtatccaactttacc
cagacggtagacgctcctaatagcatgggactggagcagaacaaggctttatcctcagct
gtgcaagccagccccacctctcctgggggttctccatcctctccatcttctggacagcgg
tcagcaagcccttcagtgccgggtcccactaaacccaaaccaaaaaccaaacggtttcag
ctgcctctagacaaagggaatggcaagaagcacaaagtttcccatttgcggaccagttct
gaagcacacattccagaccaagaaacaacatccctgacctcaggcacagggactccagga
gcagaggctgagcagcaggatacagctagtgtggagcagtcctcccagaaggagtgtggg
caaccttcagggcaagtggctgttcttccggaagttcaggtgacccaaaatccagcaaat
gaacaagaaagtacagaacctaaaacagtggaagaagaagaaagtaatttcagctcccca
ctgatgctttggcttcagcaagaacaaaagcggaaggaaagcattactgagaaaaaaccc
aagaaaggacttgtttttgaaatttccagtgatgatggctttcagatctgtgcagaaagt
attgaagatgcctggaagtcattgacagataaagtccaggaagctcgatcaaatgcccgc
ctaaagcagctctcatttgcaggtgttaacggtttgaggatgctggggattctccatgat
gcagttgtgttcctcattgagcagctgtctggtgccaagcactgtcgaaattacaaattc
cgtttccacaagccagaggaggccaatgaaccccccttgaaccctcatggctcagccagg
gctgaagtccacctcaggaagtcagcatttgacatgtttaactttctggcttctaaacat
cgtcagcctcctgaatacaaccccaatgatgaagaagaggaggaggtacagctgaagtca
gctcggagggcaactagcatggatctgccaatgcctatgcgcttccggcacttaaaaaag
acttctaaggaggcagttggtgtctacaggtctcccatccatggccggggtcttttctgt
aagagaaacattgatgcaggtgagatggtgattgagtatgccggcaacgtcatccgctcc
atccagactgacaagcgggaaaagtattacgacagcaagggcattggttgctatatgttc
cgaattgatgactcagaggtagtggatgccaccatgcatggaaatgctgcacgcttcatc
aatcactcgtgtgagcctaactgctattctcgggtcatcaatattgatgggcagaagcac
attgtcatctttgccatgcgtaagatctaccgaggagaggaactcacttacgactataag
ttccccattgaggatgccagcaacaagctgccctgcaactgtggcgccaagaaatgccgg
aagttcctaaactaa

DBGET integrated database retrieval system