KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129847Help
Entry
101129847         CDS       T02442                                 

Gene name
ST6GAL2
Definition
beta-galactoside alpha-2,6-sialyltransferase 2 isoform 1
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Class
Metabolism; Glycan biosynthesis and metabolism; N-Glycan biosynthesis [PATH:ggo00510]
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ggo00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2A
AA seq 529 aa AA seqDB search
MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRA
IMGAAHEPSPPGGLDARQALPRAHPAGSFHAGPGDLQKWAQSQDGFEHKEFFSSQVGRKS
QSAFYPEDDDYFFAAGQPGWHSHTQGTLGFPSPGEPGPREGAFPAAQVQRRRVKKRHRRQ
RRSHVLEEGDDGDRLYSSMSRAFLYRLWKGNVSSKMLNPRLQKAMKDYLTANKHGVRFRG
KREAGLSRAQLLCQLRSRARVRTLDGTEAPFSALGWRRLVPAVPLSQLHPRGLRSCAVVM
SAGAILNSSLGEEIDSHDAVLRFNSAPTRGYEKDVGNKTTVRIINSQILTNPSHHFIDSS
LYKDVILVAWDPAPYSANLNLWYKKPDYNLFTPYIQHRQRNPNQPFYILHPKFIWQLWDI
IQENTKEKIQPNPPSSGFIGILIMMSMCREVHVYEYIPSVRQTELCHYHELYYDAACTLG
AYHPLLYEKLLVQRLNTGTQGDLHRKGKVVLPGFQAVHCPAPSPVIPHS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccacacttgaagcaatggagacaacgaatgcttttcggaatattcgcttggggg
ctcctctttttgctgattttcatctacttcaccgacagcaaccccgctgagcctgtaccc
agctccctctccttcctggagaccaggaggctcctgccggtgcaggggaagcagcgggcc
atcatgggcgccgcgcatgagccctccccgcctgggggcctggacgcacgccaggcgctg
ccccgcgcccacccagccggttcctttcatgcggggcctggagacctgcagaaatgggcc
cagtcccaagatgggtttgaacataaagagtttttttcatcccaggtgggaagaaaatct
caaagtgctttctacccggaggatgacgactacttttttgctgctggtcagccagggtgg
cacagccacactcaggggacattgggattcccttcccccggggagccaggcccgcgggag
ggggcttttccggctgcacaggtccagaggaggcgggtgaagaagaggcaccggaggcag
agaaggagccacgtgttggaggagggcgacgacggcgacaggctgtactcctccatgtcc
agggccttcctgtaccggctttggaaggggaacgtctcctccaaaatgctgaacccgcgc
ctgcagaaggcgatgaaggattacctgaccgccaacaagcacggggtgcgcttccgcggg
aagcgggaggccgggctgagcagggcgcagctgctgtgccagctgcggagccgcgcgcgc
gtgcggacgctggacggcaccgaggcgcccttttctgcgctgggctggcggcgcctggtg
cccgccgtgcccctgagccagctgcacccgcgcggcctgcgcagctgcgctgtcgtcatg
tctgcaggcgcaatcctcaactcttccttgggcgaggaaatagattctcatgatgcagtt
ttgagatttaactctgctcctacacgtggttatgagaaagatgttgggaataaaaccacc
gtacgcatcattaattcgcagattctgaccaaccccagccatcacttcattgacagttca
ctgtataaagacgtcattttggtggcctgggaccctgccccatattccgcaaatcttaac
ctgtggtacaaaaaaccggattacaacctgttcactccatatattcagcatcgtcagaga
aacccaaatcagccattttacattcttcatcctaaatttatatggcagctctgggatatt
atccaggagaacactaaagagaagattcaaccaaacccaccatcttctggtttcattgga
atcctcatcatgatgtccatgtgcagagaggtgcacgtctatgaatatatcccatccgtg
cggcagacggagctgtgccactaccacgagctgtactacgacgcagcctgcaccctcggg
gcgtaccacccactactctatgagaagctcctggtgcagcgcctgaacacgggcacgcag
ggggatttgcatcgcaagggcaaggtggttctgcccggcttccaggcggtgcactgccct
gcaccaagtccagtcattccacactcttaa

DBGET integrated database retrieval system