KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129927Help
Entry
101129927         CDS       T02442                                 

Gene name
POMT1
Definition
protein O-mannosyl-transferase 1 isoform 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101129927 (POMT1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     101129927 (POMT1)
Glycosyltransferases [BR:ggo01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101129927 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 725 aa AA seqDB search
MWGFLKRPVVVTADINLSLVALTGMGLLSRLWRLTYPRAVVFDEVYYGQYISFYMKQIFF
LDDSGPPFGHMVLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALAGALSVPMAY
QIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFFNCQKHS
PFSLSWWFWLTLTGVACSCAVGIKYMGVFTYVLVLGVAAVHAWHLIGDQTLSNVCVFCHL
LARAVALLVIPVVLYLLFFYVHLILVFRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
FGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPR
RHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYNISMPAQN
LWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVGEKLSRGY
HGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLALRSDDSE
HKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIWVSGSLALAIYALLSLWYLLRRR
RNVHDLPQDAWLRWVLAGALCAGGWAVNYVPFFLMEKTLFLYHYLPALTFQILLLPVVLQ
HISDHLCRSQLQRSVFSALVVAWYSSACHVSNTLRPLTYGDKSLSPHELKALRWKDSWDI
LIRKH
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtggggatttttgaagcgccctgtagtggtgacggctgacatcaacttgagccttgtg
gccctgactgggatggggttactgagccggctgtggcgactcacctacccgcgggctgtg
gtttttgacgaagtatattatgggcagtacatctctttttacatgaaacaaatcttcttc
ttggatgacagtgggccgccatttggccacatggtgctggccttgggaggttatttagga
ggattcgatggcaattttttgtggaacagaattggagcagaatacagtagcaacgtgcct
gtgtggtccctgcgcctgctgccagcactcgcgggggccttgtcggtccccatggcctac
cagatagtgttggagctccacttttctcactgtgccgccatgggagctgctctgttgatg
cttatcgagaatgctctcatcactcagtcaaggctaatgcttttggaatcagtgttaata
tttttcaatctgttggccgtgttgtcctacctgaagttcttcaactgccaaaagcacagc
cctttttctctgagctggtggttctggctaacactgacaggggtcgcttgttcctgcgca
gtgggcatcaagtacatgggtgtgttcacatacgtgctcgtgctgggtgttgcagctgtc
catgcctggcacctgattggagaccagactttgtccaatgtctgtgtgttctgtcacttg
ctcgcccgagcagtggctttgctggtcatcccggtcgtcctgtacttactgttcttctac
gtccacttgattctagtcttccgctctgggccccacgaccaaatcatgtccagtgccttc
caggccagcttagagggaggactagctcggatcacccagggtcagccactggaggtggcc
ttcgggtcccaggtcactctgaggaacgtctttgggaaacctgtgccctgctggcttcat
tcccaccaggacacctaccccatgatatatgagaacggccgaggcagctcccaccagcaa
caggtgacctgttaccccttcaaagacgtcaataactggtggattgtaaaggatcccagg
aggcaccagctggtggtgagcagccctccgagacctgtgaggcatggggacatggtgcag
ctggtccacggcatgaccacccgctccctgaacacgcatgatgttgcagctcccctgagc
ccccattcacaggaggtctcctgctacattgactataacatctccatgcccgcccagaac
ctctggagactggaaattgtgaacagaggatctgacacagacgtctggaagaccatcctc
tcagaggtccgctttgtgcacgtgaacacttccgctgtcttaaagctgagtggggctcac
ctccctgactgggggtatcggcagctggagatcgtcggggagaagctgtcccggggctac
cacgggagcacggtgtggaacgtggaggagcaccgatacggcgcgagccaggagcagagg
gagcgggaacgggagctgcactcacctgcgcaggtggacgtcagcaggaacctcagcttc
atggcgagattctcggagctgcagtggaggatgctggcgctgagaagtgatgactcggaa
cacaagtacagctccagcccgctggagtgggtcaccctggacaccaatattgcctactgg
ctgcaccccaggaccagcgctcaaatccacctacttggaaacatagtgatctgggtttcg
ggcagcctcgctctggccatctacgccctgctgtccttgtggtacctgctccgacggcga
agaaatgtccatgacctccctcaggatgcctggctgcgctgggtgctggctggggcgctg
tgtgccggtggctgggcagtgaactacgtcccgttcttcctgatggagaagacactcttc
ctctaccactacctgcccgcactcaccttccaaatccttctgctccctgtggtcctgcag
cacatcagcgaccacctgtgcaggtcccagctccagaggagcgtcttcagcgccctggtg
gtggcctggtactcctccgcatgccacgtatccaacacactgcgcccactcacctacggc
gacaagtcactctcgccacatgaactcaaggcccttcgctggaaagacagctgggacatc
ttgatccgaaaacactag

DBGET integrated database retrieval system