KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129927Help
Entry
101129927         CDS       T02442                                 

Gene name
POMT1
Definition
(RefSeq) protein O-mannosyltransferase 1
  KO
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Other types of O-glycan biosynthesis
Mannose type O-glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosyntheis
    101129927 (POMT1)
   00514 Other types of O-glycan biosynthesis
    101129927 (POMT1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     101129927 (POMT1)
Glycosyltransferases [BR:ggo01003]
 O-Glycan biosynthesis
  O-linked Man type
   101129927 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
ENSGGOG00000012525
Position
9
AA seq 852 aa AA seqDB search
MGGSPLRFLKAARLLRVHRNPGTQNSSTRGRGGRRVSHLLLLRDRRPRPLRTRVTLAQCA
RALLPVWPRRLGESNVEQGGGWCGVPSGLTPNRRASRTVLRRCREPGAALCGLGETRGVC
LSPLFYKMWGFLKRPVVVTADINLSLVALTGMGLLSRLWRLTYPRAVVFDEVYYGQYISF
YMKQIFFLDDSGPPFGHMVLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALAGA
LSVPMAYQIVLELHFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKF
FNCQKHSPFSLSWWFWLTLTGVACSCAVGIKYMGVFTYVLVLGVAAVHAWHLIGDQTLSN
VCVFCHLLARAVALLVIPVVLYLLFFYVHLILVFRSGPHDQIMSSAFQASLEGGLARITQ
GQPLEVAFGSQVTLRNVFGKPVPCWLHSHQDTYPMIYENGRGSSHQQQVTCYPFKDVNNW
WIVKDPRRHQLVVSSPPRPVRHGDMVQLVHGMTTRSLNTHDVAAPLSPHSQEVSCYIDYN
ISMPAQNLWRLEIVNRGSDTDVWKTILSEVRFVHVNTSAVLKLSGAHLPDWGYRQLEIVG
EKLSRGYHGSTVWNVEEHRYGASQEQRERERELHSPAQVDVSRNLSFMARFSELQWRMLA
LRSDDSEHKYSSSPLEWVTLDTNIAYWLHPRTSAQIHLLGNIVIWVSGSLALAIYALLSL
WYLLRRRRNVHDLPQDAWLRWVLAGALCAGGWAVNYVPFFLMEKTLFLYHYLPALTFQIL
LLPVVLQHISDHLCRSQLQRSVFSALVVAWYSSACHVSNTLRPLTYGDKSLSPHELKALR
WKDSWDILIRKH
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgggtgggagcccactgcgctttttaaaagctgcacgtctgcttagagtacacagaaat
cctggcacacaaaacagtagcacccgagggaggggaggtcgccgcgtttcacacctgctt
ctcctccgggaccggcgccctcgcccgctgcgcacgcgcgtcaccctggcccagtgcgca
cgcgcgctgctgcccgtctggccccgcaggctcggtgaatcgaacgttgagcagggcggt
gggtggtgcggagtgccgagcggcctcacccccaaccgtcgggccagtcggacggttctg
aggcgttgccgggagccgggcgcggctctgtgtggactcggagaaacgcggggcgtctgc
ctgagcccgcttttctacaagatgtggggatttttgaagcgccctgtagtggtgacggct
gacatcaacttgagccttgtggccctgactgggatggggttactgagccggctgtggcga
ctcacctacccgcgggctgtggtttttgacgaagtatattatgggcagtacatctctttt
tacatgaaacaaatcttcttcttggatgacagtgggccgccatttggccacatggtgctg
gccttgggaggttatttaggaggattcgatggcaattttttgtggaacagaattggagca
gaatacagtagcaacgtgcctgtgtggtccctgcgcctgctgccagcactcgcgggggcc
ttgtcggtccccatggcctaccagatagtgttggagctccacttttctcattgtgccgcc
atgggagctgctctgttgatgcttatcgagaatgctctcatcactcagtcaaggctaatg
cttttggaatcagtgttaatatttttcaatctgttggccgtgttgtcctacctgaagttc
ttcaactgccaaaagcacagccctttttctctgagctggtggttctggctaacactgaca
ggggtcgcttgttcctgcgcagtgggcatcaagtacatgggtgtgttcacatacgtgctc
gtgctgggtgttgcagctgtccatgcctggcacctgattggagaccagactttgtccaat
gtctgtgtgttctgtcacttgctcgcccgagcagtggctttgctggtcatcccggtcgtc
ctgtacttactgttcttctacgtccacttgattctagtcttccgctctgggccccacgac
caaatcatgtccagtgccttccaggccagcttagagggaggactagctcggatcacccag
ggtcagccactggaggtggccttcgggtcccaggtcactctgaggaacgtctttgggaaa
cctgtgccctgctggcttcattcccaccaggacacctaccccatgatatatgagaacggc
cgaggcagctcccaccagcaacaggtgacctgttaccccttcaaagacgtcaataactgg
tggattgtaaaggatcccaggaggcaccagctggtggtgagcagccctccgagacctgtg
aggcatggggacatggtgcagctggtccacggcatgaccacccgctccctgaacacgcat
gatgttgcagctcccctgagcccccattcacaggaggtctcctgctacattgactataac
atctccatgcccgcccagaacctctggagactggaaattgtgaacagaggatctgacaca
gacgtctggaagaccatcctctcagaggtccgctttgtgcacgtgaacacttccgctgtc
ttaaagctgagtggggctcacctccctgactgggggtatcggcagctggagatcgtcggg
gagaagctgtcccggggctaccacgggagcacggtgtggaacgtggaggagcaccgatac
ggcgcgagccaggagcagagggagcgggaacgggagctgcactcacctgcgcaggtggac
gtcagcaggaacctcagcttcatggcgagattctcggagctgcagtggaggatgctggcg
ctgagaagtgatgactcggaacacaagtacagctccagcccgctggagtgggtcaccctg
gacaccaatattgcctactggctgcaccccaggaccagcgctcaaatccacctacttgga
aacatagtgatctgggtttcgggcagcctcgctctggccatctacgccctgctgtccttg
tggtacctgctccgacggcgaagaaatgtccatgacctccctcaggatgcctggctgcgc
tgggtgctggctggggcgctgtgtgccggtggctgggcagtgaactacgtcccgttcttc
ctgatggagaagacactcttcctctaccactacctgcccgcactcaccttccaaatcctt
ctgctccctgtggtcctgcagcacatcagcgaccacctgtgcaggtcccagctccagagg
agcgtcttcagcgccctggtggtggcctggtactcctccgcatgccacgtatccaacaca
ctgcgcccactcacctacggcgacaagtcactctcgccacatgaactcaaggcccttcgc
tggaaagacagctgggacatcttgatccgaaaacactag

DBGET integrated database retrieval system