KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101130021Help
Entry
101130021         CDS       T02442                                 

Gene name
SPHK2
Definition
sphingosine kinase 2
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Fc gamma R-mediated phagocytosis
Tuberculosis
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101130021 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    101130021 (SPHK2)
   04020 Calcium signaling pathway
    101130021 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    101130021 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    101130021 (SPHK2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     101130021 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 620 aa AA seqDB search
MNGHPEAEEQQDQRPDQELTRSWGHGPRSTLVRAKAMAPPPXXLAASTPLLHGEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFQADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHTFCPSSIRQPAGGLRLQHFQQRLPSMDDSPELPTGCSQYARE
LPSSSTTAGSGVLKIYSGSC
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccctgaagcagaggagcagcaggaccagaggccagaccaggagctgacc
aggagctggggccacgggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccnnnnnnactggctgccagcaccccgctcctccatggcgagtttggctcctacccagcc
cgaggcccacgctttgccctcacccttacatcgcaggccctgcacatacagcggctgcgc
cccaaacctgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccaggcagatggggcc
gccacctacgaagagaaccgtgccgaggcccagcgctgggccactgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggccg
ccgcggttgcttctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgagtgggatggc
atcgtcacggtctcgggagacgggctgctccatgaggtgctgaacgggctcctagatcgc
cctgactgggaggaagctgtgaagatgcctgtgggcatcctcccctgcggctcgggcaac
gcgctggccggagcagtgaaccagcatgggggatttgagccagctctgggcctcgacctg
ttgctcaactgctcactgttgctgtgccggggtggtggccacccactggacctgctctcc
gtgacgctggcctcgggctcccgctgtttctccttcctgtctgtggcctggggcttcgtg
tcagatgtggatatccagagcgagcgcttcagggccttgggcagtgcccgcttcacactg
ggcacggtgctgggcctcgccacactgcacacctaccgcggacgcctctcctacctcccc
gccactgtggaacccgcctcgcccacccctgcccatagcctgccccgtgccaagtcggag
ctgaccctaaccccagacccagctccgcccatggcccactcacccctgcatcgttctgtg
tctgacctgcctcttcccctgccccagcctgccctggcctctcctggctcgccagaaccc
ctgcccatcctgtccctcaacggtgggggcccagagctggctggggactggggtggggct
ggggatgctccgctgtccccggacccactgctgtcttcacctcctggctctcccaaggca
gctctacactcacccgtctccgaaggggcccccgtaattcccccatcctctgggctccca
cttcccacccctgatgcccgggtaggggcctccacctgcggcccgcccgaccacctgctg
cctccgctgggcaccccgctgcccccagactgggtgacgctggagggggactttgtgctc
atgttggccatctcgcccagccacctaggcgctgacctggtggcagctccgcataccttc
tgcccttcctccatccgacagcccgcgggaggactcagactccagcacttccagcagcgc
ctgccctctatggacgacagcccggagctgcccacgggctgcagccagtatgccagggag
ctgccctcttcttccacaacagctggctctggggttctcaagatttattcaggatcgtgt
taa

DBGET integrated database retrieval system