KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101130053Help
Entry
101130053         CDS       T02442                                 

Gene name
LYZL2
Definition
lysozyme-like protein 2
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 194 aa AA seqDB search
MQDAHLSCLSPTKWSSVSSADSTEKSASGAGTRNRPFQFCLRQALRMKAAGILTLIGCLV
IGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGI
FQINSFAWCRRGKLKENNHCHVACSALITDDLTDAILCAKKIVKETQGMNYWQGWKKHCE
GRDLSDWKKDCEVS
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgcccacctgagctgcctgtcaccgactaagtggagcagtgtttcttccgca
gactcaactgagaagtcagcctctggggcaggcaccaggaatcggccttttcagttctgt
ctccggcaggctttgaggatgaaggctgcgggcattctgaccctcattggctgcctggtc
ataggcgccgagtccaaaatctacactcgctgcaaactggcaaaaatattctcgagggct
ggcctggacaattactggggcttcagcctcggaaactggatctgcatggcgtattatgag
agcggctacaacaccacggcccagacggtcctggatgacggcagcatcgactatggcatc
ttccagatcaacagcttcgcgtggtgcagacgcggaaagctgaaggagaacaaccactgc
cacgtcgcctgctcagccttgatcactgatgacctcacagatgcgattctctgtgccaag
aaaattgttaaagagacacaaggaatgaactattggcaaggctggaagaaacactgtgag
gggagagacctgtccgactggaaaaaagactgtgaggtttcctaa

DBGET integrated database retrieval system