KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101130698Help
Entry
101130698         CDS       T02442                                 

Gene name
MMP8
Definition
neutrophil collagenase
Orthology
K01402  
matrix metalloproteinase-8 (neutrophil collagenase) [EC:3.4.24.34]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.34  neutrophil collagenase
     101130698 (MMP8)
Peptidases [BR:ggo01002]
 Metallo Peptidases
  Family M10
   101130698 (MMP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 467 aa AA seqDB search
MFSLKTLPFLLLLHVQISKAFPVSSKEKNTKIVQDYLEKFYQLPSNQYQSTRKNGTNVIV
EKLKEMQRFFGLNVTGKPNEETLDMMKKPRCGVPDSGGFMLTPGNPKWEHTNLTYRIRNY
TPQLSVAEVERAIKDAFELWGVASPLIFTRISQGEADINIAFYQRDHGDNSPFDGPNGIL
AHAFQPGQGIGGDAHFDAEETWTNTSASYNLFLVAAHEFGHSLGLAHSSDPGALMYPNYA
FRETSNYSLPQDDIDGIQAIYGLSSNPIQPTGPSTPKPCDPSLTFDAITTLRGEILFFKD
RYFWRRHPQLQRVEMNFISLFWPSLPTGIQAAYEDFDRDLIFLFKGNQYWALSGYDILQG
YPKDISNYGFPSSVQAIDAAVFYRSKTYFFVNDQFWRYDNQRQFMEPGYPKSISGAFPGI
ESKVDAVFQQQHFFLFFSGPRYYAFDLIAQRVTRVARGNKWLNCRYG
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgttctccctgaagacgcttccatttctgctgttactccatgtgcagatttccaaggcc
tttcctgtatcttctaaagagaaaaatacaaaaattgttcaggactacctggaaaagttc
taccaattaccaagcaaccagtatcagtctacaaggaagaatggcactaatgtgatcgtt
gaaaagcttaaagaaatgcagcgattttttgggttgaatgtgacggggaagccaaatgag
gaaactctggacatgatgaaaaagcctcgctgtggagtgcctgacagtggtggttttatg
ttaaccccaggaaaccccaagtgggaacacactaacttgacctacaggattcgaaactat
accccacagctgtcagtggctgaggtagaaagagctatcaaggatgcctttgaactctgg
ggtgttgcatcgcctctcatcttcaccaggatctcacagggagaggcagatatcaacatt
gctttttaccaaagagatcacggtgacaattctccatttgatggacccaatggaatcctt
gctcatgcctttcagccaggccaaggtattggaggagatgctcattttgatgccgaagaa
acatggaccaacacctccgcaagttacaacttgtttcttgttgctgctcatgaatttggc
cattctttggggctcgctcactcctctgaccctggtgccttgatgtatcccaactatgct
ttcagggaaaccagcaactactcactccctcaagatgacatcgatggcattcaggccatc
tatggactttcaagcaaccctatccaacctactggaccaagcacacccaaaccctgtgac
cccagtttgacatttgatgctatcaccacactccgtggagaaatacttttctttaaagac
aggtacttctggagaaggcatcctcagctacaaagagtcgaaatgaattttatttctcta
ttctggccatcccttccaaccggtatacaggctgcttatgaagattttgacagagacctc
attttcctatttaaaggcaaccaatactgggctctgagtggctatgatattctgcaaggt
tatcccaaggatatatcaaactatggcttccccagcagtgtccaagcaattgacgcagct
gttttctacagaagtaaaacatacttctttgtaaatgaccaattctggagatatgataac
caaagacaattcatggaaccaggttatcccaaaagcatatcaggtgcctttccaggaata
gagagtaaggttgatgcagttttccagcaacaacatttcttccttttcttcagtggacca
agatattacgcatttgatcttattgctcagagagttaccagagttgcaagaggcaataaa
tggcttaactgtagatatggctga

DBGET integrated database retrieval system