KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131020Help
Entry
101131020         CDS       T02442                                 

Gene name
PADI2
Definition
protein-arginine deiminase type-2
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101131020 (PADI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 665 aa AA seqDB search
MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEE
VATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISL
DVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKD
MSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVK
YTGGSAELLFFVEGLCFPDEGFSGLVSIHVSLLEYMAQDIPLTPIFTDTVIFRIAPWIMT
PNILPPVSVFVCCMKDNYLFLKEVKNLVEKTNCELKVCFQYLNRGDRWIQDEIEFGYIEA
PHKGFPVVLDSPRDGNLKDFPVKELLGPDFGYVTREPLFESVTSLDSFGNLEVSPPVTVN
GKTYPLGRILIGSSFPLSGGRRMTKVVHDFLKAQQVQAPVELYSDWLTVGHVDEFMSFVP
IPGTKKFLLLMASTSACYKLFREKQKDGHGEAIMFKGLGGMSSKRITINKILSNESLVQE
NLYFQRCLDWNRDILKKELGLTEQDIIDLPALFKMDEDHRARAFFPNMVNMIVLDKDLGI
PKPFGPQVEEECCLEMHVRGLLEPLGLECTFIDDISAYHKFLGEVHCGTNVRRKPFTFKW
WHMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcgagcggaccgtgcggctgcagtacgggagccgcgtggaggcggtgtacgtg
ctgggcacctacctctggaccgatgtctacagcgcggccccagccggggcccaaaccttc
agcctgaagcactcggaacacgtgtgggtggaggtggtgcgtgatggggaggctgaggag
gtggccaccaatggcaagcagcgctggcttctctcgcccagcaccaccctgcgggtcacc
atgagccaggcgagcaccgaggccagcagcgacaaggtcaccgtcaactactatgacgag
gaagggagcattcccatcgaccaggcggggctcttcctcacggccattgagatctccctg
gatgtggacgcagaccgggatggtgtagtggagaagaacaacccaaagaaggcatcctgg
acctggggccccgagggccagggggccatcctgctggtgaactgtgaccgagagacaccc
tggctgcccaaggaggactgccgtgatgagaaggtctacagcaaggaagatctcaaggac
atgtcccagatgatcctgcggaccaaaggccccgaccgcctccccgctggatacgagata
gttctgtacatttccatgtcagactcagacaaagtgggcgtgttctacgtggagaacccg
ttcttcggccaacgctatatccacatcctgggccggcggaagctctaccatgtggtcaag
tacacgggtggctccgcggagctgctgttcttcgtggaaggcctctgtttccccgacgag
ggcttctcaggcctggtctccatccatgtcagcctgctggagtacatggcccaggacatt
cccctgacacccatcttcacggacaccgtgatattccggattgctccgtggatcatgacc
cccaacatcctgcctcccgtgtcggtgtttgtgtgctgcatgaaggataattacctgttc
ctgaaagaggtgaagaaccttgtggagaaaaccaactgtgagctgaaagtctgcttccag
tacctaaaccgaggcgatcgctggatccaggatgaaattgagtttggctacatcgaagcc
ccccataaaggcttccccgtggtgctggactccccccgagatggaaacctaaaggacttc
cctgtgaaggagctcctgggcccagattttggctacgtgacccgggagcccctctttgag
tctgtcaccagccttgactcgtttggaaacctggaggtcagtcccccagtgaccgtgaac
ggcaagacatacccgcttggccgcatcctcatcgggagcagctttcctctgtctggtggt
cggaggatgaccaaggtggtgcatgacttcctgaaggcccagcaggtgcaggcgcccgtg
gagctctactcagactggctgactgtgggccacgtggatgagttcatgtcctttgtcccc
atccccggcacaaagaaattcctgctactcatggccagcacctcggcctgctacaagctc
ttccgagagaagcagaaggacggccatggagaggccatcatgttcaaaggcttgggtggg
atgagcagcaagcgaatcaccatcaacaagattctgtccaacgagagccttgtgcaggag
aacctgtacttccagcgctgcctggactggaaccgtgacatcctcaagaaggagctggga
ctgacagagcaggacatcattgacctgcccgctctgttcaagatggacgaggaccaccgt
gccagagccttcttcccaaacatggtgaacatgatcgtgctggacaaggacctgggcatc
cccaagccattcgggccacaggttgaggaggaatgctgcctggagatgcatgtgcgtggc
ctcctggagcccctgggcctcgaatgcaccttcatcgacgacatttctgcctaccacaaa
tttctgggggaagtccactgtggcaccaacgtccgcaggaagcccttcaccttcaagtgg
tggcacatggtgccctga

DBGET integrated database retrieval system