KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131537Help
Entry
101131537         CDS       T02442                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  
glycogen synthase [EC:2.4.1.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Starch and sucrose metabolism
Metabolic pathways
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101131537 (GYS2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101131537 (GYS2)
   04152 AMPK signaling pathway
    101131537 (GYS2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101131537 (GYS2)
   04922 Glucagon signaling pathway
    101131537 (GYS2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    101131537 (GYS2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101131537 (GYS2)
Glycosyltransferases [BR:ggo01003]
 Polysaccharide
  Storage polysaccharide
   101131537 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
UniProt: 
Position
12
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDI
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctgtctgtaacatccctgggtgggcttccccagtgggaagtc
gaagaacttcctgtggaggagttactgctctttgaagttgcttgggaagtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gagaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgtcagaagagcagtggatgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggctattcagcttggaatctggacaggtggaagggtgacctctgggaagcatgcagtgtt
ggcattccttatcatgaccgagaagccaacgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcatgcagatggtaaacatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccacgctacactacttgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacattgacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcttccgttcattgcgctcacgtgttcaccacggtttctgaa
ataacagcaatagaggctgaacatatgctgaagagaaagcctgatgtagttactccaaac
ggcttgaatgttaagaaattttcagcagtgcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctcgacttcgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacatc
acagtggtggtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacagctgtgggatgttgcacattctgtaaaggaaaagttt
ggaaaaaaactctacgatgcattattaagaggagaaattcctgacctgaatgatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
aggcggattggacttttcaacaaccgcacagatagagtcaaggtgattttgcacccagag
tttctatcctccaccagtcccttactacccatggactatgaagagtttgttagaggttgt
catcttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgaccacgaatctctccgggtttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactaagtttctctatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccagacacctgacattaagcagagcttttccagataaa
ttccatgtggaactaacatcaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcaggcctccagtcctcagagcagtgatgtggaa
gatgaagtggaggatgagagatacgatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcaccattttcactgagccacgttcctcatgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system