KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132628Help
Entry
101132628         CDS       T02442                                 

Gene name
ALPP
Definition
LOW QUALITY PROTEIN: alkaline phosphatase, placental type
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101132628 (ALPP)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101132628 (ALPP)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101132628 (ALPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 523 aa AA seqDB search
MLGPCMLLLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIF
LGDGSWNPRGQRSGSGSPCLPQRRAQSVSVPRHTMXTNVPDSAATATAYLCGVKGNFQTI
GLSAPARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTWVQHASPAGTYAHTVNRNWYS
DTNMPCSARQEGCKDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDYSQGGTRLDG
KNLVQEWLAKHQGARYVWNHTELMQASLDPSVTHLMGLFEPGDMKYEIHRDSTLDPSLME
MTEAALRLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERAGQLTSEEDT
LSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVLKDGARPDVT
ESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHVMAFAACLEP
YTACDLAPPAGTTDAAHPGPSVVPGLLPLLAGTLLLLGTATAP
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgctggggccctgcatgctgctgctgctgctgctgggcctgaggctacagctctccctg
ggcatcatcccagttgaggaggagaacccggacttctggaaccgccaggcagccgaggcc
ctgggtgccgccaagaagctgcagcctgcacagacagccgccaagaacctcatcatcttc
ctgggcgacggcagttggaatcccagaggacagagatcagggtctgggtctccgtgtctg
ccccagagaagagctcagagtgtctctgtccccagacatacaatgtagacaaacgtgcca
gacagtgcagccacagccacggcctacctgtgcggggtcaagggtaacttccagaccatc
ggcttgagtgcacccgcccgctttaaccagtgcaacacgacacgcggcaacgaggtcatc
tccgtgatgaatcgggccaagaaagcagggaagtcagtgggagtggtaaccaccacatgg
gtgcagcacgcctcaccagccggcacctatgcccacacggtgaaccgcaactggtactcg
gacaccaacatgccttgctcggcccgccaggagggctgcaaggacatcgccacgcagctc
atctccaacatggacattgacgtgatcctaggtggaggccgaaagtacatgtttcccatg
gggaccccagaccctgagtacccagatgactacagccaaggtgggaccaggctggacggg
aagaatctggtgcaggaatggctggcgaagcaccagggtgcccggtacgtgtggaaccac
actgagctcatgcaggcttccctggacccgtctgtgacccatctcatgggtctctttgag
cctggagacatgaaatacgagatccaccgagactccacgctggacccctccctgatggag
atgacagaggctgccctgcgcctgctgagcaggaacccccgcggcttcttcctcttcgtg
gagggtggtcgcatcgaccatggtcatcatgaaagcagggcttaccgggcactgactgag
acgatcatgttcgacgacgccattgagagggcgggccagctcaccagcgaggaggacacg
ctgagcctcgtcactgctgaccactcccacgtcttctccttcggaggctaccccctgcga
gggagctccatcttcgggctggcccctggcaaggcccgggacaggaaggcctacacggtc
ctcctatacggaaacggtccaggctatgtgctcaaggacggcgcccggccggatgttacc
gagagcgagagcgggagccccgagtatcggcagcagtcagcagtgcccctggacggagag
acccacgcaggcgaggacgtggcggtgttcgcgcgcggcccgcaggcgcacctggttcac
ggcgtgcaggagcagaccttcatagcgcacgtcatggccttcgctgcctgcctggagccc
tacaccgcctgcgacctggcgccccccgccggcaccaccgacgccgcgcacccggggccg
tccgtggtccccgggctgcttcctctgctggcagggaccttgctgctgctggggacggcc
actgctccctga

DBGET integrated database retrieval system