KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132763Help
Entry
101132763         CDS       T02442                                 

Gene name
PAICS
Definition
LOW QUALITY PROTEIN: multifunctional protein ADE2
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101132763 (PAICS)
Enzymes [BR:ggo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     101132763 (PAICS)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.6  phosphoribosylaminoimidazolesuccinocarboxamide synthase
     101132763 (PAICS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 432 aa AA seqDB search
MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKI
TSCIFQLLQEAVTSYKSNRIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNP
GVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLVIGQTEVDIMSHATQAVF
EILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRD
LKEVTPEGLQMVKKNFEWVAERVELLLKSESXYTVVVLMSSTSDLGHCENIKACRNVGTP
CELSTHRGPNETLKIKAACEGDGIGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPL
TPDWGAQDVWSSLRLPSGLGCSTILSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISL
KQADKKIRECNL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggcgacagctgaggtactgaacattggtaaaaaattgtatgagggtaaaacaaaagaa
gtctacgaattgttagatagtccaggaaaagtcctcctgcagtccaaggaccagattaca
gcaggaaatgcagctagaaaaaaccacctggaaggaaaagctgcaatctcaaataaaatc
accagttgtatttttcagttattacaggaagcagttacctcatataagtcgaatcgtatt
aaaactgccttcaccagaaaatgtggggagacagctttcattgcaccccagtgtgaaatg
attccaattgaatgggtttgcagaagaatagcaactggttcttttctcaaaagaaatcct
ggtgtcaaggaaggatataagttttacccacctaaagtggagttgtttttcaaggatgat
gccaataatgacccacagtggtctgaggaacagctgattgctgcaaaattttgctttgct
ggacttgttataggccagactgaagtggatatcatgagtcatgctacacaggctgtattt
gaaatactggagaaatcctggttgccccagaattgtacactggttgatatgaagattgaa
tttggtgttgatgtaaccaccaaagaaattgttcttgctgatgttattgacaatgattcc
tggagactctggccatcaggagatcgaagccaacagaaagacaaacagtcttatcgggac
ctcaaagaagtaactcctgaagggctccaaatggtaaagaaaaactttgagtgggttgca
gagagagtagagttgcttttgaaatcggaaagttagtacacagttgtagtattgatgagc
tctacttctgatcttggtcactgtgaaaacatcaaggcctgtagaaatgttggcactcca
tgtgaactatccacacacagaggaccaaatgaaaccctaaaaattaaagctgcgtgtgaa
ggggatggcattggggatggcattcctactgtatttgtggcagtggcaggcagaagtaat
ggtttgggaccagtgatgtctgggaacactgcatatccagttatcagctgtcctcccctc
acaccagactggggagctcaggatgtgtggtcttctcttcgactacccagtggtcttggc
tgttcaaccatactttctccagaaggatcagctcaatttgctgctcagatatttgggtta
agcaaccatttggtatggagcaaactgcgagcgagcattttgaacacatggatttccttg
aagcaggctgacaagaaaatcagagaatgtaatttataa

DBGET integrated database retrieval system