KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133457Help
Entry
101133457         CDS       T02442                                 

Gene name
PADI3
Definition
protein-arginine deiminase type-3
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101133457 (PADI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 665 aa AA seqDB search
MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYVSPNMERGR
ERADTRRWRFDETLEIIVVMNSPSNDLNDSHVQISYHSSHKPLPLAYAVLYLTCVDISLD
CDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCGVQDNCDQHVHCLQDLEDM
SVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHVCGPEDVCEAYRHVLGQEKVSYEVP
RFHGDEERFFVEGLSFPDAGFTGLIFFHVTLLDDSNKDFPASPIFTDTVVFRVAPWIMTP
STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENHNDRWIQDEMELGYVQAP
HKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDRSVSGLDSFGNLEVSPPVVANG
KEYPLGRILIGGNLPGNDSRQMHQALQDFLSAQQVQAPVKLYSDWLSVGHVDEFLSFVPA
PDRKGFRLLLASPRSCYKLFQEQQNEGHGEALLFEGIKSNEQVSVQKIKNILSNKTLREH
NSFVERCIDWNRELLKRELGLAESDIIDIPQLFKLKEFSKAEAFFPNMVNMLVLGKHLGI
PKPFGPVINGRCCLEEKVCSLLEPLGLQCTFINDFFTYHIRHGEVHCGTNVRRKPFSFKW
WNMVP
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgcagagaatcgtgcgtgtgtccctggagcatcccaccagcgcggtgtgtgtg
gctggcgtggagaccctcgtggacatttatgggtcagtgcctgagggcacagaaatgttt
gaggtctatgggacgcctggcgtggacatctacgtctcgcccaacatggagaggggccgg
gagcgtgcagacaccaggcggtggcgctttgacgagactttggagatcatcgtggtcatg
aactcccccagcaatgacctcaacgacagccatgttcagatttcctaccactccagccat
aagcctctgcccctggcctacgcggtgctctacctcacctgtgttgacatctctctggat
tgcgacctgaactgtgagggaaggcaggacaggaactttgtagacaagcggcagtgggtc
tgggggcccagtgggtatggcggcatcttgctggtgaactgtgaccgtgatgatccaagc
tgtggtgtccaggacaactgtgaccagcacgtgcactgcctgcaagacctggaagacatg
tctgtcatggtcctgcggacgcagggccctgcagccctctttgatgaccacaaacttgtc
ctccatacctccagctatgatgccaaacgggcacaggtcttccacgtctgcggtcctgag
gatgtgtgtgaggcctataggcatgtgctggggcaagaaaaggtgtcctacgaggtaccc
cgcttccatggggatgaggagcgcttcttcgtggaaggcctgtccttccctgatgccggc
ttcacaggactcatcttcttccatgtcactctgctggacgactccaacaaggatttcccg
gcatcccctatcttcactgacactgtggtgttccgagtggcaccctggatcatgacgccc
agcaccctgccgcccctagaggtgtatgtgtgccgtgtcaggaacaacacgtgttttgtg
gatgcggtggcagagctggccaggaaggccggctgcaagctgaccatctgcccacaggcc
gagaaccacaacgaccgctggatccaggatgagatggagctgggctacgttcaggcgccg
cacaagaccctcccagtggtctttgactccccaaggaatggggaactgcaggatttccct
tacaaaagaatcctgggtccagattttggttacgtgactcgggaaccacgcgacaggtct
gtgagtggcctggactcctttgggaacctggaggtcagccccccagtggtggccaatggg
aaagagtaccccctggggaggatcctcattgggggcaacctgcctggcaatgacagccgg
cagatgcaccaggccctgcaggacttcctcagtgcccagcaggtgcaggcccctgtgaag
ctctattctgactggctgtccgtgggccacgtggacgagttcctgagctttgtgcctgca
cccgacaggaagggcttccggctgctcctggccagccccaggtcctgctacaaactgttc
caggagcagcagaatgagggccacggggaggccctgctgttcgaagggatcaagagtaat
gaacaagtttcagtgcagaaaataaagaacattctgtcaaacaagacgttgagagaacat
aattcatttgtggagagatgcatcgactggaaccgggagctgctgaagcgggagctgggc
ctggccgagagtgacatcattgacatccctcagctcttcaagctcaaagagttctccaag
gccgaagcttttttccccaacatggtgaacatgctggtgctagggaagcacctgggcatc
cccaagcccttcgggcccgtcatcaacggccgctgctgcctggaggagaaggtgtgttcc
ctgctggagccactgggcctccagtgcaccttcatcaacgacttcttcacctaccacatc
aggcatggggaggtgcactgcggcaccaacgtgcgcagaaagcccttctccttcaagtgg
tggaacatggtgccctga

DBGET integrated database retrieval system