KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133572Help
Entry
101133572         CDS       T02442                                 

Gene name
ENTPD2
Definition
ectonucleoside triphosphate diphosphohydrolase 2 isoform 1
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101133572 (ENTPD2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     101133572 (ENTPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 495 aa AA seqDB search
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPA
DKENDTGIVGQHSSCDVPGGGISSYADNPSGAGQSLVGCLEQALQDVPKERHAGTPLYLG
ATAGMRLLNLTNPEASTSVLTAVTHTLTQYPFDFRGAHILSGQEEGVFGWVTANYLLENF
IKYGWVGRWFRPWKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSF
LCYGRDQVLQRLLASALQTHGSHPCWPRGFSTQVLLGDVYQSPCTMAQRPQTFNSSARVS
LSGSSDPHLCRDLVSGLFSFSSCSFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMG
LPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERSF
GGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDVSSWVVLLLLFASALLAALV
LLLRQVHSAKLPSTI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaaggtgcggtcactgctgccgccgctgctgctggccgccgcgggcctcgcc
ggcctcctactgctgtgcgtccccacccgcgacgtccgggagccgcccgccctcaagtat
ggcatcgtcctggacgctggttcttcacacacgtccatgtttatctacaagtggccggca
gacaaggagaacgacacaggcattgtgggccagcatagctcctgtgatgttccaggtggg
ggcatctccagctatgcagacaacccttctggggccggccagagtcttgttggatgcctt
gaacaggcgcttcaggatgtgcccaaagagagacatgcgggcacacccctctacctggga
gccacagcgggtatgcgcctgctcaacctgaccaatccagaggcctcgaccagtgtactc
acggcagtgactcacacactgacccagtacccctttgacttccggggtgcacacatcctc
tcgggccaggaagagggggtgtttggctgggtgactgccaactacctgctggagaacttc
atcaagtacggctgggtgggccggtggttccggccatggaaggggacactgggggccatg
gacctggggggtgcctctacccagatcacctttgagacaaccagtccagctgaggacaga
gccagcgaggtccagctgcatctctacggccagcactaccgagtctacacccacagcttc
ctctgctatggccgtgaccaggtcctccagaggctgttggccagcgccctccagacccac
ggctcccacccctgctggccgaggggcttttccacccaagtgctgctcggggatgtgtac
cagtcaccatgcaccatggcccagcggccccagaccttcaacagcagtgccagggtcagc
ctgtcagggagcagtgacccccacctctgccgagatctggtttctgggctcttcagcttc
tcctcctgctccttctcccgatgctctttcaatggggtcttccagcccccagtggctggg
aactttgtcgccttctctgccttcttctacactgtggactttttgcggacttcgatgggg
ctgcccgtggccaccctgcagcagctggaggcagccgcagtgaatgtctgcaaccagacc
tgggctcagctgcaagctcgggtgccagggcaacgggcccgcctggccgactactgcgcc
ggggccatgttcgtgcagcagctgctgagtcgcggctacggcttcgacgagcgctccttc
ggcggcgtgatcttccagaagaaggccgcggacactgcagtgggctgggcgctcggctac
atgctgaacctgaccaacctgatccccgccgacccgccggggctgcgcaagggcacagac
gtcagctcctgggtcgtcctcctgctgctcttcgcctccgcgctcctggctgcgcttgtc
ctgctgctgcgtcaggtgcactccgccaagctgccaagcaccatttag

DBGET integrated database retrieval system