KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134492Help
Entry
101134492         CDS       T02442                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Endocrine resistance
MAPK signaling pathway
Rap1 signaling pathway
FoxO signaling pathway
Sphingolipid signaling pathway
Cellular senescence
Adrenergic signaling in cardiomyocytes
VEGF signaling pathway
Osteoclast differentiation
Signaling pathways regulating pluripotency of stem cells
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
IL-17 signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Dopaminergic synapse
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Prolactin signaling pathway
Relaxin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Amyotrophic lateral sclerosis (ALS)
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Influenza A
Kaposi's sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Proteoglycans in cancer
Fluid shear stress and atherosclerosis
Module
MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    101134492 (MAPK12)
   04010 MAPK signaling pathway
    101134492 (MAPK12)
   04370 VEGF signaling pathway
    101134492 (MAPK12)
   04668 TNF signaling pathway
    101134492 (MAPK12)
   04068 FoxO signaling pathway
    101134492 (MAPK12)
   04071 Sphingolipid signaling pathway
    101134492 (MAPK12)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    101134492 (MAPK12)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101134492 (MAPK12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101134492 (MAPK12)
   04620 Toll-like receptor signaling pathway
    101134492 (MAPK12)
   04621 NOD-like receptor signaling pathway
    101134492 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    101134492 (MAPK12)
   04660 T cell receptor signaling pathway
    101134492 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    101134492 (MAPK12)
   04659 Th17 cell differentiation
    101134492 (MAPK12)
   04657 IL-17 signaling pathway
    101134492 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    101134492 (MAPK12)
   04670 Leukocyte transendothelial migration
    101134492 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    101134492 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    101134492 (MAPK12)
   04917 Prolactin signaling pathway
    101134492 (MAPK12)
   04926 Relaxin signaling pathway
    101134492 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101134492 (MAPK12)
  Nervous system
   04728 Dopaminergic synapse
    101134492 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    101134492 (MAPK12)
   04722 Neurotrophin signaling pathway
    101134492 (MAPK12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101134492 (MAPK12)
  Development
   04380 Osteoclast differentiation
    101134492 (MAPK12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101134492 (MAPK12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101134492 (MAPK12)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101134492 (MAPK12)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101134492 (MAPK12)
  Infectious diseases
   05132 Salmonella infection
    101134492 (MAPK12)
   05133 Pertussis
    101134492 (MAPK12)
   05152 Tuberculosis
    101134492 (MAPK12)
   05164 Influenza A
    101134492 (MAPK12)
   05160 Hepatitis C
    101134492 (MAPK12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101134492 (MAPK12)
   05169 Epstein-Barr virus infection
    101134492 (MAPK12)
   05145 Toxoplasmosis
    101134492 (MAPK12)
   05140 Leishmaniasis
    101134492 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    101134492 (MAPK12)
  Drug resistance
   01522 Endocrine resistance
    101134492 (MAPK12)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101134492 (MAPK12)
Protein kinases [BR:ggo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101134492 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
ENSGGOG00000014464
Position
22
AA seq 283 aa AA seqDB search
MRHENVIGLLDVFTPDETLDNFTDFYLVMPFMGTDLGKLMKHEKLGEDRIQFLVYQMLKG
LRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADSEMTGYVVTRWYRAPEVILNW
MRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKN
YMKGLPEWEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAAEALAHPYFESLHDTEDE
PQVQKYDDSFDDVDRTLDGWKREWGAPGTACVDPSGGLWAGPV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
aacttcacagacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgccggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggactttggcctggccagacaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctattcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaatgggagaagaaggattttgcctccatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acggcagccgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgtggaccgcacactggatggatgg
aagcgtgagtggggggctcctggcacggcctgtgtggacccaagtggggggctctgggca
gggcctgtgtga

DBGET integrated database retrieval system