KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134599Help
Entry
101134599         CDS       T02442                                 

Gene name
MLL3
Definition
histone-lysine N-methyltransferase MLL3
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ggo00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 4782 aa AA seqDB search
MSEIKEQSAEEDAEAEVDNSKQLIPTLQRSVSEESANSLVSVGVEAKISEQLCAFCYCGE
KSSLGQGDLKQFRITPGFILPWRNQPSNKKDIDDNSNGTYEKMQNSAPRKQRGQRKERSP
QQNIVSCVSVSTQTASDDQAGKLWDELSLVGLPDAIDIQALFDSTGTCWAHHRCVEWSLG
VCQMEEPLLVNVDKAVVSGSTERCAFCKRFGATIKCCEEKCTQMYHYPCAAGAGSFQDFS
HIFLLCPEHIDQAPERYLLDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPECKVCQNCK
QSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTNGWKCKNCRICIECGTRSSSQWHHNCLI
CDNCYQQQDNLCPFCGKCYHPELQKDMLHCNMCKRWVHLECDKPTDHELDTQLKEEYICM
YCKHLGAEMDPLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAVNKDVNGQESTPGI
VPDAVQVHTEEQQKSHPSESLDTDSLLIAVSSQHTVNTELEKQISNEVDSEEMKMSSEVK
HICGEDQIEDKMEVTENIEVVTHQITVQQEQLQLLEEPKTVVSKEESRPPKLVIESVTLP
LETLVSPHEESTSLCPEEQLVIERLQGEKEQKENSELSTGLMDSEMTPTIEGCVKDVSYQ
GGKSIKLSSETESSFSSSADISKADVSSSPTPSSDLPSHDMLHNYTSALSSSAGNIMPTT
YISVTPKIGMGKPAITKRKFSPGRPRSKQEAWSTHNTVSPPSWSPDXSEGREIFKPRQLP
GSAIWSIKVGRGSGFPGKRRPRGAGLSGRGGRGRSKLKSGIGAVVLPGVSTADISSNKDD
EENSMHNTVVLFSSSDKFTLNQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKGNT
GFCEFRNQNERFKGWRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKG
GWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCYRNYREEDLILQCRQCD
SSMKVFLLIGIVRRKGQDPPKTYTQDGVCLTESGMTQLQSLTVTVPRRKRSKPKLKLKII
NQNSVAVLQTPPDIQSEHSRDGEMDDSREGELMDCDGKSESSPEREAVDDETKGVEGTDG
VKKRKRKPYRPGIXXXMVRQRSRTGQGKTKRSVIRKDSSGSISEQLPCRDDGWSEQLPDT
LVDESVSVTESTEKIKKRYRKRKNKLEETFPAYLQEAFFGKDLLDTSRQSKISLDNLSED
GAQLLYKTNMNTGFLDPSLDPLLSSSSAPTKSGTHGPADDPLADISEVLNTDDDILGIIS
DDLAKSVDHSDVGPVTDDPSSLPQPNVNQSSRPLSEEQLDGILSPELDKMVTDGAILGKL
YKIPELGGKDVEDLFTAVLSPANTQPTPLPQPPPPTQLLPVHNQDVFSRMPLMNGLIGPS
PHLPHNSLPPGSGLGTFSAIAQSSYPDARDKNSAFNPMASDPNNSWTSSAPTVEGENDTM
SNAQRSTLKWEKEEALGEMATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLWRKASSQE
RAPYVQKARDNRAALRINKVQMSNDSMKRQQQQDSIDPSSRIDSELFKDPLKQRESEHEQ
EWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQQQQQQFGSQHLLVQSGSDTPSSGIQSP
LTPQPGNGNMSPAQSFHKELFTKQPPSTPASTSSDDVFVKPQAPPPPPAPSRIPIQDSLS
QAQTSQPPSPQVFSPGSSNSRPPSPMDPYAKMVGTPRPPPVGHSFSRRNSAAPVENCTPL
SSVSRPLQMNETTANRPSPVRDLCSSSTTNNDPYAKPPDTPRPVMTDQFPKSLGLSRSPV
VSEQTAKGPVAAGTSDHFTKPSPRADVFQRQRIPDSYARPLLTPAPLDSGPGPFKTPMQP
PPSSQDPYGSGSQASRRLSVDPYERPALTPRPIDNFSHNQSNDPYSQPPLTPHPAMNESF
AHPSRAFSQPGTISRPTSQDPYSQPPGTPRPVVDSYSQSSGTARSNTDPYSQPPGTPRPT
TVDPYSQQPQTPRPSTQTDLFVTPVTNQRHSDPYAHPPGTPRPGISVPYSQPPATPRPRI
SEGFTRSSMTRPVLMPNQDPFLQAAQNRGPALPGPLVRPPDTCSQTPRPPGPGLSDTFSR
VSPSAARDPYDQPPMTPRSQSDSFGTSQTAHDVADQARPGSEGSFCASSNSPMHSQGQQF
SGVSQLPGPVPTSGVTDTQNTVNMAQADTEKLRQRQKLREIILQQQQQKKIAGRQEKGSQ
DSPAVPHPGPLQHWQPENVNQAFTRPPPPYPGNIRSPVAPSLGPRYAVFPKDQRGPYPPD
VASMGMRPHGFRFGFPGGSHGTMPSQERFLVPPQQIQGSGVSPQLRRSISVDMPRPLNNS
QMNNPVGLPQHFSPQSLPVQQHNILGQAYIELRHRAPDGRQRLPFSAPPGNIVEASSNLR
HGNFIPRPDFPGPRHADPMRRPPQGLPNQLPVHPDLEQVPPSQQEQGHSVHSSSMVLRTL
NHPLGGEFSEAPLSTSVPSETTSDNLQITTQPSDGLEEKLDSDDPSVKELDVKDLEGVEV
KDLDDEDLENLNLDTEDGKVVELDTLDNLETNDPNLDDLLRSGEFDIIAYTDPELDMGDK
KSMFNEELDLPIDDKLDNQCVSVEPKKKEQENKTLVLSDKHSPQKKSTVTNEVKTEVLSP
NSKVESKCETEKNDENKDNVDTPCSQASAHSDLNDGEKTSLHPCDPDLFEKRTSRETAGP
GGNVIQASTQLPAQDVINSCGITGSTPVLSSLLANEKSDNSDIRPLGSPPPPTLPASPSN
HVSSLPPLIAPPGRVLDNTMNSNVTVVSRVNHVFSQGVQVNPGFIPGQSTVNHNLGTGKP
TTQTGPLTSQSGTSSMSGPQQLMIPQTLAQQNRERPLLLEEQPLLLQDLLDQERQEQQQQ
RQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALKGINKVMAQNNLGMPPMVMSRFPFM
GQAVTGTQNGEGQNLGPQAIPQDGSITHQISRPNPPNFGPGFVNDSQRKQYEEWLQETQQ
LLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKQLE
QIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMPSVQPQPPLIPGATPPTMSQPAFPMVPQ
QLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGT
VSNANPQSGPPPRVEFDDNNPFSESFQERERKERLREQQERQRIQLMQEVDRQRALQQRM
EMEQHGMVGSEISSSRTSVSQISFYSSDLPCDFMQPLGPLQQSPQHQQQMGQVLQQQNIQ
QGSINSPSTQTFMQTNERRQVGPPSFVPDSPSIPVGSPNFSSVKQGHGNLSGTSFQQSPV
RPSFTPALPAAPPVANSSLPCGQDSTITHGHSYPGSTQSLIQLYSDIIPEEKGKKKRTRK
KKRDDDAESTKAPSTPHSDITAPPTPGISETTSTPAVSTPSELPQQADQESVEPVGPSTP
NMAAGQLCTELENKLPNSDFSQATPNQQAYANSEIDKLSMETPAKTEEIKLEKAETESCP
GQEEPKLEEQNGSKVEGNAVSCPVSSAQSPPHSAGTPAAKGDSGNELLKHLLKNKKSSSL
LNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQTLGAQMQGGFGCGNQLPKTDGGSETKKQ
RSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSSTDTFTHLKQQNNLSNPPTPPASLPPTPP
PMACQKMANGFATTEELAGKAGVLVSHEVTKTLGPKPFQLPFRPQDDLLARALAQGPKTV
DVPASLPTPPHNNQEELRIQDHCGDRDTPDSFVPSSSPESVVGVEVSRYPDLSLVKEEPP
EPVPSPIIPILPSTAGKSSESRRNDIKTEPGTLYFASPFGPSPNGPRSGLISVAITLHPT
AAENISSVVAAFSDLLHVRIPNSYEVSNAPDVPSMGLVNSHRINPGLEYRQHLLLRGPPP
GSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKDSSHGIAESAALRPQWCCHCKVVILGSG
VRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNCFILYSSTAQAKNSENKESIPSLPQSPM
RETPSKAFHQYSNNISTLDVHCLPQLPEKASPPASPPIAFPPAFEAAQVEAKPDELKVTV
KLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKLGTS
LKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVHLNCALWSTEVYETQAGALIN
VELALRRGLQMKCVFCHKTGATSGCHRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPK
GIHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAF
HSPKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGRPVFVIRIVEQGHEDLVLSDIS
PKGVWDKILEPVACVRKKSEMLQLFPAYLKGEDLFGLTVSAVARIAESLPGVEACENYTF
RYGRNPLMELPLAVNPTGCARSEPKMSAHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAP
YSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEV
ANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAPNCVAEVVTFERGHKII
ISSNRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKWMN
NT seq 14349 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatcaaagaacaatctgcagaagaggatgctgaagcagaagtggataacagc
aaacagctaattccaactcttcagcgatctgtgtctgaggaatcggcaaactccctggtc
tctgttggtgtagaagccaaaatcagtgaacagctctgcgctttttgttactgtggggaa
aaaagttccttaggacaaggagacttaaaacaattcagaataacgcctggatttatcttg
ccgtggagaaaccaaccttctaacaagaaggacattgatgacaacagcaatggaacctat
gagaaaatgcaaaactcagcaccacgaaaacaaagaggacagagaaaagaacgatctcct
cagcagaatatagtatcttgtgtaagtgtaagcacccagacagcttcagatgatcaagct
ggtaaactgtgggatgaactcagtctggttgggcttccagatgccattgatatccaagcc
ttatttgattctacaggcacttgttgggctcatcaccgttgtgtggagtggtcactagga
gtatgccagatggaagaaccattgttagtgaacgtggacaaagctgttgtctcagggagc
acagaacgatgtgcattttgtaagcgctttggggccactatcaaatgctgtgaagagaaa
tgtacccagatgtatcattatccttgtgctgcgggagccggctcctttcaggatttcagt
cacatcttcctgctttgtccagaacacattgaccaagctcctgaaagatacctcttagat
cagttcttttgtactacttgtggtcagcactatcatggaatgtgcctggatatagcggtt
actccattaaaacgtgcaggttggcaatgtcctgagtgcaaagtgtgccagaactgcaaa
caatcgggagaagatagcaagatgctagtgtgtgatacgtgtgacaaagggtatcatact
ttttgtcttcaaccagttatgaaatcagtaccaaccaatggctggaaatgcaaaaattgc
agaatatgtatagagtgtggcacacggtctagttctcagtggcaccacaattgcctgata
tgtgacaattgttaccaacagcaggataacttatgtcctttctgtgggaagtgttatcat
ccagaattgcagaaagacatgcttcattgtaatatgtgcaaaaggtgggttcacctagag
tgtgacaaaccaacagatcatgaactggatactcagctcaaagaagagtatatctgcatg
tattgtaaacacctgggagctgagatggatcctttacagccaggtgaggaagtggagata
gctgagctcactacagattataacaatgaaatggaagttgaaggccctgaagatcaaatg
gtattctcagagcaggcagttaataaagatgtcaacggtcaggagtccactcctggaatt
gttccagatgcggttcaagtccacactgaagagcaacagaagagtcatccctcagaaagt
cttgacacagatagtcttcttattgctgtatcatcccaacatacagtgaataccgaattg
gaaaaacagatttctaatgaggttgatagtgaagaaatgaaaatgtcttctgaagtgaag
catatttgtggtgaagatcaaattgaagataaaatggaagtgacagaaaacattgaagtc
gttacacaccagatcactgtgcagcaagagcaactgcagttgttagaggaacctaaaaca
gtggtatccaaagaagaatcaaggcctccaaaattagtcattgaatctgtcactcttcca
ctagaaaccttagtgtccccacatgaggaaagcacttcattatgtcctgaggaacagttg
gttatagaaaggctacaaggagaaaaggaacagaaagaaaattctgaactttctactgga
ttgatggactctgaaatgactcctacgattgagggttgtgtgaaagatgtttcataccaa
ggaggcaaatctataaagttatcatctgagacagagtcatcattttcctcatcagcagac
ataagcaaggcagatgtgtcttcctccccaacaccttcttcagacttgccttcgcatgac
atgctgcataattacacttcagctcttagttcctctgctggaaacatcatgccaacaact
tacatctcagtcactccaaaaattggcatgggtaaaccagctattactaagagaaaattt
tctcctggtagacctcggtccaaacaggaggcttggagtacccataatacagtgagccca
ccttcctggtccccagacatntcagaaggtcgggaaatttttaaacccaggcagcttcct
ggcagtgccatttggagcatcaaagtgggccgtgggtctggatttccaggaaagcggaga
cctcgaggtgcaggactgtcggggcgaggtggccgaggcaggtcaaagctgaaaagtgga
atcggagctgttgtattgcctggggtgtctactgcagatatttcatcaaataaggatgat
gaagaaaactctatgcacaatacagttgtgttgttttctagcagtgacaagttcactttg
aatcaggatatgtgtgtagtttgtggcagttttggccaaggagcagaaggaagattactt
gcctgttctcagtgtggtcagtgttaccatccatactgtgtcagtattaagggtaataca
ggtttttgtgagtttaggaatcaaaatgaaagattcaaaggttggaggtgtcttgagtgc
actgtgtgtgaggcctgtgggaaggcaactgacccaggaagactcctgctgtgtgatgat
tgtgacataagttatcacacctactgcctagaccctccattgcagacagttcccaaagga
ggctggaagtgcaaatggtgtgtttggtgcagacactgtggagcaacatctgcaggtcta
agatgtgaatggcagaacaattacacacagtgcgctccttgtgcaagcttatcttcctgt
ccagtctgctatcgaaactatagagaagaagatcttattctgcaatgtagacaatgtgat
agctctatgaaagtttttctgttaatagggatagttaggagaaaagggcaagacccaccc
aagacttatacccaggatggtgtgtgtttgactgaatcagggatgactcagttacagagc
ctcacagttacagttccaagaagaaaacggtcaaaaccaaaattgaaattgaagattata
aatcagaatagcgtggccgtccttcagacccctccagacatccaatcagagcattcaagg
gatggtgaaatggatgatagtcgagaaggagaacttatggattgtgatggaaaatcagaa
tctagtcctgagcgggaagctgtggatgatgaaactaagggagtggaaggaacagatggt
gtcaaaaagagaaaaaggaaaccatacagaccaggtatannnnnnnnnatggtgcggcaa
agaagtcgaactgggcaagggaaaaccaaaagatctgtgatcagaaaagattcctcaggc
tctatttctgagcagttaccttgcagagatgatggctggagtgagcagttaccagatact
ttagttgatgaatctgtttctgttactgaaagcactgaaaaaataaagaagagataccga
aaaaggaaaaataagcttgaagaaactttccctgcctatttacaagaagctttctttgga
aaagatcttctagatacaagtagacaaagcaagataagtttagataatctatcagaggat
ggagctcagcttttatataaaacaaacatgaacacaggtttcttggatccttccttagat
ccactacttagttcatcctcggctccaacaaaatctggaactcacggtcctgctgatgac
ccattagctgatatttctgaagttttaaacacagatgatgacattcttggaataatttca
gatgatctagcaaaatcagttgatcattcagatgttggtcctgtcactgatgatccttcc
tctttgcctcagccaaatgtcaatcagagttcacgaccattaagtgaagaacagctagat
gggatcctcagtcctgaactagacaaaatggtcacagatggagcaattcttggaaaatta
tataaaattccagagcttggcggaaaagatgttgaagacttatttacagctgtacttagt
cctgcgaacactcagccaactccattgccacagcctcccccaccaacacagctgttgcca
gtacacaatcaggatgttttttcacggatgcctctcatgaatggccttattggacccagt
cctcatctcccacataattctttgccacctggaagcggactgggaactttctctgcaatt
gcacaatcctcttatcctgatgccagggataaaaattcagcctttaatccaatggcaagt
gatcctaacaactcttggacatcatcagctcccactgtggaaggagaaaatgacacaatg
tcgaatgcccagagaagcacgcttaagtgggagaaagaggaggctctgggtgaaatggca
acagttgccccagttctctacaccaatattaatttccccaacttaaaggaagaattccct
gattggactactagagtgaagcaaattgccaaattgtggagaaaagcaagctcacaagaa
agagcaccatatgtgcaaaaagccagagataacagagctgctttacgcattaataaagta
cagatgtcaaatgattccatgaaaaggcagcaacagcaagatagcattgatcccagctct
cgtattgattcggagctctttaaagatcctttaaagcaaagagaatcagaacatgaacag
gaatggaaatttagacagcaaatgcgtcagaaaagtaagcagcaagctaaaattgaagcc
acacagaaacttgaacaggtgaaaaatgagcagcagcagcagcaacaacagcaatttggt
tctcagcatcttctggtgcagtctggttcagatacaccaagtagtgggatacagagtccc
ttgacacctcagcctggcaatggaaatatgtctcctgcacagtcattccataaagaactg
tttacaaaacagccacccagtacccctgcgtctacatcttcagatgatgtgtttgtaaag
ccacaagctccacctcctcctccagccccatcccggattcccatccaggatagtctttct
caggctcagacttctcagccaccctcaccacaagtgttttcacctgggtcctctaactca
cgaccaccatctccaatggatccatatgcaaaaatggttggtacccctcgaccacctcct
gtgggccatagtttttccagaagaaattctgctgcaccagtggaaaactgtacaccttta
tcatcggtatctaggccccttcaaatgaatgagacaacagcaaataggccatcccccgtc
agagatttatgttcttcttccacgacaaataatgacccctatgcaaaacctccagacaca
cctaggcctgtgatgacagatcaatttcccaaatccttgggcctatcccggtctcctgta
gtttcagaacaaactgcaaaaggccctgtagcagctggaaccagtgatcactttactaaa
ccatctcctagggcagatgtgtttcaaagacaaaggatacctgactcatatgcacgaccc
ttgttgacacctgcacctcttgatagtggtcctggaccttttaagactccaatgcaacct
cctccgtcctctcaggatccttatggatcagggtcacaggcatcaaggcgattgtctgtt
gacccttatgaaaggcctgctttgacaccaagacctatagataatttttctcataatcag
tcaaatgatccatatagtcagcctcccctaaccccacatccagcaatgaatgaatctttt
gcccatccttcaagggctttttcccagcctggaaccatatcaaggccaacatctcaggac
ccatactcccaacccccaggaactccacgacctgttgtagattcttattcccaatcttca
ggaacagctaggtccaatacagacccttactctcaacctcctggaactccccggcctact
actgttgacccatatagtcagcagccccaaaccccaagaccatctacacaaactgacttg
tttgttacacctgtaacaaatcagaggcattctgatccatatgctcatcctcctggaaca
ccaagacctggaatttctgtcccttactctcagccaccagcaacaccaaggccaaggatt
tcagagggttttactaggtcctcaatgacaagaccagtcctcatgccaaatcaggatcct
ttcctgcaagcagcacaaaaccgaggaccagctttacctggcccgttggtaaggccacct
gatacatgttcccagacacctaggccccctggacctggtctttcagacacatttagccgt
gtttccccatctgctgcccgtgatccctatgatcagcctccaatgactccaagatctcag
tctgactcttttggaacaagtcaaactgcccatgatgttgctgatcaggcaaggcctgga
tcagaggggagcttctgtgcatcttcaaactctccaatgcactcccaaggccagcagttc
tctggtgtctcccagcttcctggacctgtgccaacttcaggagtaactgatacacagaat
actgtaaatatggcccaagcagatacagagaaattgagacagcggcagaagttacgtgaa
atcattctccagcagcaacagcagaagaagattgcaggtcgacaggagaaggggtcacag
gactcacccgcagtgcctcatccagggcctcttcaacactggcaaccagagaatgttaac
caggctttcaccagacccccacctccctatcctgggaacattaggtctcctgttgcccct
tctttaggacctagatatgctgttttcccaaaagatcagcgtggaccctatcctcctgat
gttgctagtatggggatgagacctcatggatttagatttggatttccaggaggtagtcat
ggtaccatgccgagtcaagagcgcttccttgtgcctcctcaacaaatacagggatctgga
gtttctccacagctaagaagatcaatatctgtagatatgcctaggcctttaaataactca
caaatgaataatccagttggacttcctcagcatttttcaccacagagcttgccagttcag
cagcataacatactgggccaagcatatattgaactgagacatagggctcctgacggaagg
caacggctgcctttcagtgctccacctggcaacattgtagaggcatcttctaatctgaga
catggaaacttcattccccggccagactttccaggccctagacacgcagaccccatgcga
cgacctccccagggtctacctaatcagctacctgtgcacccagatttggaacaagtgcca
ccatctcaacaagagcaaggtcattctgtccattcatcttctatggtcttgaggactctg
aaccatccactaggtggtgaattttcagaagctcctttgtcaacatctgttccatctgaa
acaacgtctgataatttacagataaccacccaaccttctgatggtctagaggaaaaactt
gattctgatgacccttctgtgaaggaactggatgttaaagaccttgagggggttgaagtc
aaagacttagatgatgaagatcttgaaaacttaaatttagatacagaggatggcaaggta
gttgaattggatactttagataatttggaaactaatgatcccaacctggatgacctctta
aggtcaggagagtttgatatcattgcatatacagatccagaacttgacatgggagataag
aaaagcatgtttaatgaggaactagaccttccaattgatgataagttagataatcagtgt
gtatctgttgaaccaaaaaaaaaggaacaagaaaacaaaactctggttctctctgataaa
cattcaccacagaaaaaatccactgttaccaatgaggtaaaaacggaagtattgtctcca
aattctaaggtggaatccaaatgtgaaactgaaaaaaatgatgagaataaagataatgtt
gacactccttgctcacaggcttctgctcactcagacctaaatgatggagaaaagacttct
ttgcatccttgtgatccagatctatttgagaaaagaaccagtcgagaaactgctggcccc
ggtggaaatgtcattcaagcatccactcaactacctgctcaagatgtaataaactcttgt
ggcataactggatcaactccagttctctcgagtttacttgctaatgagaaatctgataat
tcagacattaggccattggggtctccaccaccaccaactctgccggcctcaccatccaat
catgtgtcaagtttgcctcctttaatagcaccgcctggccgtgttttggataataccatg
aattctaatgtaacagtagtctctagggtaaaccatgttttttctcagggtgtgcaggta
aatccaggattcattccaggtcaatcaacagttaaccacaatctggggacaggaaaacct
acaactcaaactgggcctctaacaagtcagtctggtaccagtagcatgtctggaccccaa
cagctaatgattcctcaaacattagcacagcagaatagagagaggccccttcttctagaa
gaacagcctctacttctacaggatcttttggatcaagaaaggcaagaacagcagcagcaa
agacagatgcaagccatgattcgtcagcgatcagaaccgttcttccctaatattgatttt
gatgcaattacagatcctataatgaaagccaaaatggtggcccttaaaggcataaataaa
gtgatggcacaaaacaatctgggcatgccaccaatggtgatgagcaggttcccttttatg
ggccaggcggtaactggaacacagaatggtgaaggacagaaccttggaccacaggccatt
cctcaggatggcagtataacacatcagatttctaggcctaatcctccaaattttggtcca
ggctttgtcaatgattcacagcgtaagcagtatgaagagtggctccaggagacccaacag
ctgcttcaaatgcagcagaagtatcttgaagaacaaattggtgctcacagaaaatctaag
aaggccctttcagctaaacaacgtactgccaagaaagctgggcgtgaatttccagaggaa
gatgcagaacaactcaagcatgttactgaacagcaaagcatggttcagaaacagctagaa
cagattcgtaaacaacagaaagaacatgctgaattgattgaagattatcggatcaaacag
cagcagcaatgtgcaatggccccacctaccatgatgcccagtgtccagccccagccaccc
ctaattccaggtgccactccacccaccatgagccaacccgcctttcccatggtgccacag
cagcttcagcaccagcagcacacaacagttatttctggccatactagccctgttagaatg
cccagtttacctggatggcaacccaacagtgctcctgcccacctgcccctcaatcctcct
agaattcagcccccaattgcccaattaccaataaaaacttgtacaccagccccagggaca
gtctcaaatgcaaatccacagagtggaccaccacctcgggtagaatttgatgacaacaat
ccctttagtgaaagttttcaagaacgggaacgtaaggaacgtttacgagaacagcaagag
agacagcggatccaactcatgcaggaggtagatagacaaagagctttgcagcagaggatg
gaaatggagcaacatggcatggtgggctctgagataagtagtagtaggacatctgtgtcc
cagatttccttctacagttccgacttaccttgtgattttatgcaacctctaggacccctt
cagcagtctccacaacaccaacagcaaatggggcaggttttacagcagcagaatatacaa
caaggatcaattaattcaccctccacccaaactttcatgcagactaatgagcgaaggcag
gtaggccctccttcatttgttcctgattcaccatcaatccctgttggaagcccaaatttt
tcttctgtgaagcagggacatggaaatctttctgggaccagcttccagcagtccccagtg
aggccttcttttacacctgctttaccagcagcacctccagtagctaatagcagtctccca
tgtggccaagattctactataacccatggacacagttatccgggatcaacccaatcgctt
attcagttgtattctgatataatcccagaggaaaaagggaaaaagaaaagaacaagaaag
aagaaaagagatgatgatgcagaatccaccaaggctccatcaactccccattcagatata
actgccccaccgactccaggcatctcagaaactacctctactcctgcagtgagcacaccc
agtgagcttcctcaacaagccgaccaagagtcggtggaaccagtcggcccatccactccc
aatatggcagcaggccagctatgtacagaattagagaacaaactgcccaatagtgatttc
tcacaagcaactccaaatcaacaggcatacgcaaattcagaaatagataagctctccatg
gaaacccctgccaaaacagaagagataaaactggaaaaggctgagacagagtcctgccca
ggccaagaggagcctaaattggaggaacagaatggtagtaaggtagaaggaaacgctgta
tcctgtcctgtctcctcagcacagagtcctccccattctgctgggacccctgctgccaaa
ggagactcagggaatgaacttctgaaacacttgttgaaaaataaaaagtcatcttctctt
ttgaatcaaaaacctgagggcagtatttgttcagaagatgactgtacaaaggataataaa
ctagttgagaagcagaacccagctgaaggactgcaaactttgggggctcaaatgcaaggt
ggttttggatgtggcaaccagttgccaaaaacagatggaggaagtgaaaccaagaaacag
cgaagcaaacggactcagaggacgggtgagaaagcagcacctcgctcaaagaaaaggaaa
aaggacgaagaggagaaacaagctatgtactctagcactgacacgtttacccacttgaaa
cagcagaataatttaagtaatcctccaacaccccctgcctctcttcctcctacaccacct
cctatggcttgtcagaagatggccaatggttttgcaacaactgaagaacttgctggaaaa
gccggagtgttagtgagccatgaagttaccaaaactctaggacctaaaccatttcagctg
cccttcagaccccaggatgacttgttggcccgagctcttgctcagggccccaagacagtt
gatgtgccagcctccctcccaacaccacctcataacaatcaggaagaattaaggatacag
gatcactgtggtgatcgagatactcctgacagttttgttccctcatcctctcctgagagt
gtggttggggtagaagtgagcaggtatccagatctgtcattggtcaaggaggagcctcca
gaaccggtgccgtcccccatcattccaattcttcctagcactgctgggaaaagttcagaa
tcgagaaggaatgacataaaaactgagccgggcactttatattttgcgtcaccttttggt
ccttccccaaatggtcccagatcaggtcttatatctgtagcaattactctgcatcctaca
gctgctgagaacattagcagtgttgtggctgcgttttccgaccttcttcacgtccgaatc
cctaacagctatgaggttagcaatgctccagatgtcccatccatgggtttggtcaatagc
cacagaatcaacccgggtttggagtatcgacagcatttacttctccgtgggcctccgcca
ggatctgcaaaccctcccagattagtgagctcttaccggctgaagcagcctaatgtacca
tttcctccaacaagcaatggtctttctggatataaggattctagtcatggtattgcagaa
agcgcagcactcagaccacagtggtgttgtcattgtaaagtggttattcttggaagtggt
gtgcggaaatctttcaaagatctgacccttttgaacaaggattcccgagaaagcaccaag
agggtagagaaggacattgtcttctgtagtaataactgctttattctttattcatcaact
gcacaagcgaaaaactcagaaaacaaggaatccattccttcattgccacaatcacctatg
agagaaacgccttccaaagcatttcatcagtacagcaacaacatctccactttggatgtg
cactgtctcccccagctcccagagaaagcttctccccctgcctcaccgcccatcgccttc
cctcctgcttttgaagcagcccaagtcgaggccaaaccagatgagctgaaggtgacagtc
aagctgaagcctcggctaagagctgtccatggtgggtttgaagattgcaggccgctcaat
aaaaaatggagaggaatgaaatggaagaagtggagcattcatattgtaatccctaagggg
acatttaaaccaccttgtgaggatgaaatagatgaatttctaaagaaattgggcacttcc
cttaaacctgatcctgtgcccaaagactatcggaaatgttgcttttgtcatgaagaaggt
gatggattgacagatggaccagcaaggctactcaaccttgacttggatctgtgggtccac
ttgaactgcgctctgtggtccacagaggtctatgagactcaggctggtgccttaataaat
gtggagctagctctgaggagaggcctacaaatgaaatgtgtcttctgtcacaagacaggt
gccactagtggatgccacagatttcgatgcaccaacatttatcactttacttgcgccatt
aaagcacaatgcatgttttttaaggacaaaactatgctttgccccatgcacaaaccaaag
ggaattcatgagcaagaattaagttactttgcagtcttcaggagggtctatgttcagcgc
gatgaggtgcgacagattgctagcatcgtgcaacgaggagaacgggaccatacctttcgc
gtgggtagcctcatcttccacacaattggtcagctgcttccacagcagatgcaagcattc
cattctcctaaagcactcttccctgtgggctatgaagccagccggctgtactggagcacg
cgctatgccaataggcgctgccgctacctgtgctccatcgaggagaaggatgggcgccca
gtgtttgtcatcaggattgtggaacaaggccatgaagacctggttctaagtgacatctca
cctaaaggtgtctgggataagattttggagcctgtggcgtgtgtgagaaaaaagtctgaa
atgctccagcttttcccagcgtatttaaaaggagaggatctgtttggcctgaccgtctct
gcagtggcacgcatagcggaatcactacctggggttgaggcatgtgaaaattataccttc
cgatacggccgaaatcctctcatggaacttcctcttgccgttaaccccacaggttgtgcc
cgttctgaacctaaaatgagtgcccatgtcaagaggtttgtgttaaggcctcacacctta
aacagcaccagcacctcaaagtcatttcagagcacagtcactggagaactgaacgcacct
tatagtaaacagtttgttcactccaagtcatcgcagtaccggaagatgaagactgaatgg
aaatccaatgtgtatctggcacggtctcggattcaggggctgggcctgtatgctgctaga
gacattgagaagcacaccatggtcattgagtacatcgggactatcattcgaaacgaagta
gcaaacagaaaagagaaactttatgagtctcagaaccgtggtgtgtacatgttccgcatg
gacaacgatcacgtgattgacgcaacgctcacaggagggcctgcaaggtatatcaaccat
tcgtgtgcacctaattgtgtggctgaagtggtgacttttgagagaggacacaaaattatc
atcagctccaatcggagaatccagaaaggagaagagctctgctatgactataagtttgac
tttgaagatgaccagcacaagattccgtgtcactgtggagctgtgaactgccggaagtgg
atgaactga

DBGET integrated database retrieval system