KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134599Help
Entry
101134599         CDS       T02442                                 

Gene name
KMT2C
Definition
(RefSeq) lysine methyltransferase 2C
  KO
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101134599 (KMT2C)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101134599 (KMT2C)
Transcription factors [BR:ggo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    101134599 (KMT2C)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101134599 (KMT2C)
   HMT complexes
    MLL3/MLL4 complex
     101134599 (KMT2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
7
AA seq 4509 aa AA seqDB search
MCLDIAVTPLKRAGWQCPECKVCQNCKQSGEDSKMLVCDTCDKGYHTFCLQPVMKSVPTN
GWKCKNCRICIECGTRSSSQWHHNCLICDNCYQQQDNLCPFCGKCYHPELQKDMLHCNMC
KRWVHLECDKPTDHELDTQLKEEYICMYCKHLGAEMDPLQPGEEVEIAELTTDYNNEMEV
EGPEDQMVFSEQAVNKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESLDTDSLLIAVSSQ
HTVNTELEKQISNEVDSEDMKMSSEVKHICGEDQIEDKMEVTENIEVVTHQITVQQEQLQ
LLEEPKTVVSREESRPPKLVMESVTLPLETLVSLHEESTSLCPEEQLVIERLQGEKEQKE
NSELSTGLMDSEMTPTIEGCVKDVSYQGGKSIKLSSETESSFSSSADISKADVSSSPTPS
SDLPSHDMLHNYTSALSSSAGNIMPTTYISVTPKIGMGKPAITKRKFSPGRPRSKQEAWS
THNTVSPPSWSPDXSEGREIFKPRQLPGSAIWSIKVGRGSGFPGKRRPRGAGLSGRGGRG
RSKLKSGIGAVVLPGVSTADISSNKDDEENSMHNTVVLFSSSDKFTLNQDMCVVCGSFGQ
GAEGRLLACSQCGQCYHPYCVSIKGNTGFCEFRNQNERFKGWRCLECTVCEACGKATDPG
RLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCGATSAGLRCEWQNNYTQCAP
CASLSSCPVCYRNYREEDLILQCRQCDSSMKVFLLIGIVRRKGQDPPKTYTQDGVCLTES
GMTQLQSLTVTVPRRKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGELM
DCDGKSESSPEREAVDDETKGVEGTDGVKKRKRKPYRPGIXXXMVRQRSRTGQGKTKRSV
IRKDSSGSISEQLPCRDDGWSEQLPDTLVDESVSVTESTEKIKKRYRKRKNKLEETFPAY
LQEAFFGKDLLDTSRQSKISLDNLSEDGAQLLYKTNMNTGFLDPSLDPLLSSSSAPTKSG
THGPADDPLADISEVLNTDDDILGIISDDLAKSVDHSDVGPVTDDPSSLPQPNVNQSSRP
LSEEQLDGILSPELDKMVTDGAILGKLYKIPELGGKDVEDLFTAVLSPANTQPTPLPQPP
PPTQLLPVHNQDVFSRMPLMNGLIGPSPHLPHNSLPPGSGLGTFSAIAQSSYPDARDKNS
AFNPMASDPNNSWTSSAPTVEGENDTMSNAQRSTLKWEKEEALGEMATVAPVLYTNINFP
NLKEEFPDWTTRVKQIAKLWRKASSQERAPYVQKARDNRAALRINKVQMSNDSMKRQQQQ
DSIDPSSRIDSELFKDPLKQRESEHEQEWKFRQQMRQKSKQQAKIEATQKLEQVKNEQQQ
QQQQQFGSQHLLVQSGSDTPSSGIQSPLTPQPGNGNMSPAQSFHKELFTKQPPSTPASTS
SDDVFVKPQAPPPPPAPSRIPIQDSLSQAQTSQPPSPQVFSPGSSNSRPPSPMDPYAKMV
GTPRPPPVGHSFSRRNSAAPVENCTPLSSVSRPLQMNETTANRPSPVRDLCSSSTTNNDP
YAKPPDTPRPVMTDQFPKSLGLSRSPVVSEQTAKGPVAAGTSDHFTKPSPRADVLQRQRI
PDSYARPLLTPAPLDSGPGPFKTPMQPPPSSQDPYGSGSQASRRLSVDPYERPALTPRPI
DNFSHNQSNDPYSQPPLTPHPAMNESFAHPSRAFSQPGTISRPTSQDPYSQPPGTPRPVV
DSYSQSSGTARSNTDPYSQPPGTPRPTTVDPYSQQPQTPRPSTQTDLFVTPVTNQRHSDP
YAHPPGTPRPGISVPYSQPPATPRPRISEGFTRSSMTRPVLMPNQDPFLQAAQNRGPALP
GPLVRPPDTCSQTPRPPGPGLSDTFSRVSPSAARDPYDQPPMTPRSQSDSFGTSQTAHDV
ADQARPGSEGSFCASSNSPMHSQGQQFSGVSQLPGPVPTSGVTDTQNTVNMAQADTEKLR
QRQKLREIILQQQQQKKIAGRQEKGSQDSPAVPHPGPLQHWQPENVNQAFTRPPPPYPGN
IRSPVAPSLGPRYAVFPKDQRGPYPPDVASMGMRPHGFRFGFPGGSHGTMPSQERFLVPP
QQIQGSGVSPQLRRSISVDMPRPLNNSQMNNPVGLPQHFSPQSLPVQQHNILGQAYIELR
HRAPDGRQRLPFSAPPGNIVEASSNLRHGNFIPRPDFPGPRHADPMRRPPQGLPNQLPVH
PDLEQVPPSQQEQGHSVHSSSMVLRTLNHPLGGEFSEAPLSTSVPSETTSDNLQITTQPS
DGLEEKLDSDDPSVKELDVKDLEGVEVKDLDDEDLENLNLDTEDGKVVELDTLDNLETND
PNLDDLLRSGEFDIIAYTDPELDMGDKKSMFNEELDLPIDDKLDNQCVSVEPKKKEQENK
TLVLSDKHSPQKKSTVTNEVKTEVLSPNSKVESKCETEKNDENKDNVDTPCSQASAHSDL
NDGEKTSLHPCDPDLFEKRTSRETAGPGGNVIQASTQLPAQDVINSCGITGSTPVLSSLL
ANEKSDNSDIRPLGSPPPPTLPASPSNHVSSLPPLIAPPGRVLDNTMNSNVTVVSRVNHV
FSQGVQVNPGFIPGQSTVNHNLGTGKPTTQTGPLTSQSGTSSMSGPQQLMIPQTLAQQNR
ERPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMV
ALKGINKVMAQNNLGMPPMVMSRFPFMGQAVTGTQNGEGQNLGPQAIPQDGSITHQISRP
NPPNFGPGFVNDSQRKQYEEWLQETQQLLQMQQKYLEEQIGAHRKSKKALSAKQRTAKKA
GREFPEEDAEQLKHVTEQQSMVQKQLEQIRKQQKEHAELIEDYRIKQQQQCAMAPPTMMP
SVQPQPPLIPGATPPTMSQPAFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPA
HLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQSGPPPRVEFDDNNPFSESFQERERKE
RLREQQERQRIQLMQEVDRQRALQQRMEMEQHGMVGSEISSSRTSVSQISFYSSDLPCDF
MQPLGPLQQSPQHQQQMGQVLQQQNIQQGSINSPSTQTFMQTNERRQVGPPSFVPDSPSI
PVGSPNFSSVKQGHGNLSGTSFQQSPVRPSFTPALPAAPPVANSSLPCGQDSTITHGHSY
PGSTQSLIQLYSDIIPEEKGKKKRTRKKKRDDDAESTKAPSTPHSDITAPPTPGISETTS
TPAVSTPSELPQQADQESVEPVGPSTPNMAAGQLCTELENKLPNSDFSQATPNQQAYANS
EIDKLSMETPAKTEEIKLEKAETESCPGQEEPKLEEQNGSKVEGNAVSCPVSSAQSPPHS
AGTPAAKGDSGNELLKHLLKNKKSSSLLNQKPEGSICSEDDCTKDNKLVEKQNPAEGLQT
LGAQMQGGFGCGNQLPKTDGGSETKKQRSKRTQRTGEKAAPRSKKRKKDEEEKQAMYSST
DTFTHLKQQNNLSNPPTPPASLPPTPPPMACQKMANGFATTEELAGKAGVLVSHEVTKTL
GPKPFQLPFRPQDDLLARALAQGPKTVDVPASLPTPPHNNQEELRIQDHCGDRDTPDSFV
PSSSPESVVGVEVSRYPDLSLVKEEPPEPVPSPIIPILPSTAGKSSESRRNDIKTEPGTL
YFASPFGPSPNGPRSGLISVAITLHPTAAENISSVVAAFSDLLHVRIPNSYEVSNAPDVP
SMGLVNSHRINPGLEYRQHLLLRGPPPGSANPPRLVSSYRLKQPNVPFPPTSNGLSGYKD
SSHGIAESAALRPQWCCHCKVVILGSGVRKSFKDLTLLNKDSRESTKRVEKDIVFCSNNC
FILYSSTAQAKNSENKESIPSLPQSPMRETPSKAFHQYSNNISTLDVHCLPQLPEKASPP
ASPPIAFPPAFEAAQVEAKPDELKVTVKLKPRLRAVHGGFEDCRPLNKKWRGMKWKKWSI
HIVIPKGTFKPPCEDEIDEFLKKLGTSLKPDPVPKDYRKCCFCHEEGDGLTDGPARLLNL
DLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKTGATSGCHRFRCTNI
YHFTCAIKAQCMFFKDKTMLCPMHKPKGIHEQELSYFAVFRRVYVQRDEVRQIASIVQRG
ERDHTFRVGSLIFHTIGQLLPQQMQAFHSPKALFPVGYEASRLYWSTRYANRRCRYLCSI
EEKDGRPVFVIRIVEQGHEDLVLSDISPKGVWDKILEPVACVRKKSEMLQLFPAYLKGED
LFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAVNPTGCARSEPKMSAHVKRF
VLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQG
LGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGG
PARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQHKIPCHCG
AVNCRKWMN
NT seq 13530 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctggatatagcggttactccattaaaacgtgcaggttggcaatgtcctgagtgc
aaagtgtgccagaactgcaaacaatcgggagaagatagcaagatgctagtgtgtgatacg
tgtgacaaagggtatcatactttttgtcttcaaccagttatgaaatcagtaccaaccaat
ggctggaaatgcaaaaattgcagaatatgtatagagtgtggcacacggtctagttctcag
tggcaccacaattgcctgatatgtgacaattgttaccaacagcaggataacttatgtcct
ttctgtgggaagtgttatcatccagaattgcagaaagacatgcttcattgtaatatgtgc
aaaaggtgggttcacctagagtgtgacaaaccaacagatcatgaactggatactcagctc
aaagaagagtatatctgcatgtattgtaaacacctgggagctgagatggatcctttacag
ccaggtgaggaagtggagatagctgagctcactacagattataacaatgaaatggaagtt
gaaggccctgaagatcaaatggtattctcagagcaggcagttaataaagatgtcaacggt
caggagtccactcctggaattgttccagatgcggttcaagtccacactgaagagcaacag
aagagtcatccctcagaaagtcttgacacagatagtcttcttattgctgtatcatcccaa
catacagtgaatactgaattggaaaaacagatttctaatgaagttgatagtgaagacatg
aaaatgtcttctgaagtgaagcatatttgtggcgaagatcaaattgaagataaaatggaa
gtgacagaaaacattgaagtcgttacacaccagatcactgtgcagcaagagcaactgcag
ttgttagaggaacctaaaacagtggtatccagagaagaatcaaggcctccaaaattagtc
atggaatctgtcactcttccactagaaaccttagtgtccctacatgaggaaagtacttca
ttatgtcctgaggaacagttggttatagaaaggctacaaggagaaaaggaacagaaagaa
aattctgaactttctactggattgatggactctgaaatgactcctacgattgagggttgt
gtgaaagatgtttcataccaaggaggcaaatctataaagttatcatctgagacagagtca
tcattttcctcatcagcagacataagcaaggcagatgtgtcttcctccccaacaccttct
tcagacttgccttcgcatgacatgctgcataattacacttcagctcttagttcctctgct
ggaaacatcatgccaacaacttacatctcagtcactccaaaaattggcatgggtaaacca
gctattactaagagaaaattttctcctggtagacctcggtccaaacaggaggcttggagt
acccataatacagtgagcccaccttcctggtccccagacatntcagaaggtcgggaaatt
tttaaacccaggcagcttcctggcagtgccatttggagcatcaaagtgggccgtgggtct
ggatttccaggaaagcggagacctcgaggtgcaggactgtcggggcgaggtggccgaggc
aggtcaaagctgaaaagtggaatcggagctgttgtattgcctggggtgtctactgcagat
atttcatcaaataaggatgatgaagaaaactctatgcacaatacagttgtgttgttttct
agcagtgacaagttcactttgaatcaggatatgtgtgtagtttgtggcagttttggccaa
ggagcagaaggaagattacttgcctgttctcagtgtggtcagtgttaccatccatactgt
gtcagtattaagggtaatacaggtttttgtgagtttaggaatcaaaatgaaagattcaaa
ggttggaggtgtcttgagtgcactgtgtgtgaggcctgtgggaaggcaactgacccagga
agactcctgctgtgtgatgattgtgacataagttatcacacctactgcctagaccctcca
ttgcagacagttcccaaaggaggctggaagtgcaaatggtgtgtttggtgcagacactgt
ggagcaacatctgcaggtctaagatgtgaatggcagaacaattacacacagtgcgctcct
tgtgcaagcttatcttcctgtccagtctgctatcgaaactatagagaagaagatcttatt
ctgcaatgtagacaatgtgatagctctatgaaagtttttctgttaatagggatagttagg
agaaaagggcaagacccacccaagacttatacccaggatggtgtgtgtttgactgaatca
gggatgactcagttacagagcctcacagttacagttccaagaagaaaacggtcaaaacca
aaattgaaattgaagattataaatcagaatagcgtggccgtccttcagacccctccagac
atccaatcagagcattcaagggatggtgaaatggatgatagtcgagaaggagaacttatg
gattgtgatggaaaatcagaatctagtcctgagcgggaagctgtggatgatgaaactaag
ggagtggaaggaacagatggtgtcaaaaagagaaaaaggaaaccatacagaccaggtata
nnnnnnnnnatggtgcggcaaagaagtcgaactgggcaagggaaaaccaaaagatctgtg
atcagaaaagattcctcaggctctatttctgagcagttaccttgcagagatgatggctgg
agtgagcagttaccagatactttagttgatgaatctgtttctgttactgaaagcactgaa
aaaataaagaagagataccgaaaaaggaaaaataagcttgaagaaactttccctgcctat
ttacaagaagctttctttggaaaagatcttctagatacaagtagacaaagcaagataagt
ttagataatctatcagaggatggagctcagcttttatataaaacaaacatgaacacaggt
ttcttggatccttccttagatccactacttagttcatcctcggctccaacaaaatctgga
actcacggtcctgctgatgacccattagctgatatttctgaagttttaaacacagatgat
gacattcttggaataatttcagatgatctagcaaaatcagttgatcattcagatgttggt
cctgtcactgatgatccttcctctttgcctcagccaaatgtcaatcagagttcacgacca
ttaagtgaagaacagctagatgggatcctcagtcctgaactagacaaaatggtcacagat
ggagcaattcttggaaaattatataaaattccagagcttggcggaaaagatgttgaagac
ttatttacagctgtacttagtcctgcgaacactcagccaactccattgccacagcctccc
ccaccaacacagctgttgccagtacacaatcaggatgttttttcacggatgcctctcatg
aatggccttattggacccagtcctcatctcccacataattctttgccacctggaagcgga
ctgggaactttctctgcaattgcacaatcctcttatcctgatgccagggataaaaattca
gcctttaatccaatggcaagtgatcctaacaactcttggacatcatcagctcccactgtg
gaaggagaaaatgacacaatgtcgaatgcccagagaagcacgcttaagtgggagaaagag
gaggctctgggtgaaatggcaacagttgccccagttctctacaccaatattaatttcccc
aacttaaaggaagaattccctgattggactactagagtgaagcaaattgccaaattgtgg
agaaaagcaagctcacaagaaagagcaccatatgtgcaaaaagccagagataacagagct
gctttacgcattaataaagtacagatgtcaaatgattccatgaaaaggcagcaacagcaa
gatagcattgatcccagctctcgtattgattcggagctctttaaagatcctttaaagcaa
agagaatcagaacatgaacaggaatggaaatttagacagcaaatgcgtcagaaaagtaag
cagcaagctaaaattgaagccacacagaaacttgaacaggtgaaaaatgagcagcagcag
cagcaacaacagcaatttggttctcagcatcttctggtgcagtctggttcagatacacca
agtagtgggatacagagtcccttgacacctcagcctggcaatggaaatatgtctcctgca
cagtcattccataaagaactgtttacaaaacagccacccagtacccctgcgtctacatct
tcagatgatgtgtttgtaaagccacaagctccacctcctcctccagccccatcccggatt
cccatccaggatagtctttctcaggctcagacttctcagccaccctcaccacaagtgttt
tcacctgggtcctctaactcacgaccaccatctccaatggatccatatgcaaaaatggtt
ggtacccctcgaccacctcctgtgggccatagtttttccagaagaaattctgctgcacca
gtggaaaactgtacacctttatcatcggtatctaggccccttcaaatgaatgagacaaca
gcaaataggccatcccccgtcagagatttatgttcttcttccacgacaaataatgacccc
tatgcaaaacctccagacacacctaggcctgtgatgacagatcaatttcccaaatccttg
ggcctatcccggtctcctgtagtttcagaacaaactgcaaaaggccctgtagcagctgga
accagtgatcactttactaaaccatctcctagggcagatgtgttacaaagacaaaggata
cctgactcatatgcacgacccttgttgacacctgcacctcttgatagtggtcctggacct
tttaagactccaatgcaacctcctccgtcctctcaggatccttatggatcagggtcacag
gcatcaaggcgattgtctgttgacccttatgaaaggcctgctttgacaccaagacctata
gataatttttctcataatcagtcaaatgatccatatagtcagcctcccctaaccccacat
ccagcaatgaatgaatcttttgcccatccttcaagggctttttcccagcctggaaccata
tcaaggccaacatctcaggacccatactcccaacccccaggaactccacgacctgttgta
gattcttattcccaatcttcaggaacagctaggtccaatacagacccttactctcaacct
cctggaactccccggcctactactgttgacccatatagtcagcagccccaaaccccaaga
ccatctacacaaactgacttgtttgttacacctgtaacaaatcagaggcattctgatcca
tatgctcatcctcctggaacaccaagacctggaatttctgtcccttactctcagccacca
gcaacaccaaggccaaggatttcagagggttttactaggtcctcaatgacaagaccagtc
ctcatgccaaatcaggatcctttcctgcaagcagcacaaaaccgaggaccagctttacct
ggcccgttggtaaggccacctgatacatgttcccagacacctaggccccctggacctggt
ctttcagacacatttagccgtgtttccccatctgctgcccgtgatccctatgatcagcct
ccaatgactccaagatctcagtctgactcttttggaacaagtcaaactgcccatgatgtt
gctgatcaggcaaggcctggatcagaggggagcttctgtgcatcttcaaactctccaatg
cactcccaaggccagcagttctctggtgtctcccagcttcctggacctgtgccaacttca
ggagtaactgatacacagaatactgtaaatatggcccaagcagatacagagaaattgaga
cagcggcagaagttacgtgaaatcattctccagcagcaacagcagaagaagattgcaggt
cgacaggagaaggggtcacaggactcacccgcagtgcctcatccagggcctcttcaacac
tggcaaccagagaatgttaaccaggctttcaccagacccccacctccctatcctgggaac
attaggtctcctgttgccccttctttaggacctagatatgctgttttcccaaaagatcag
cgtggaccctatcctcctgatgttgctagtatggggatgagacctcatggatttagattt
ggatttccaggaggtagtcatggtaccatgccgagtcaagagcgcttccttgtgcctcct
caacaaatacagggatctggagtttctccacagctaagaagatcaatatctgtagatatg
cctaggcctttaaataactcacaaatgaataatccagttggacttcctcagcatttttca
ccacagagcttgccagttcagcagcacaacatactgggccaagcatatattgaactgaga
catagggctcctgacggaaggcaacggctgcctttcagtgctccacctggcaacattgta
gaggcatcttctaatctgagacatggaaacttcattccccggccagactttccaggccct
agacacgcagaccccatgcgacgacctccccagggtctacctaatcagctacctgtgcac
ccagatttggaacaagtgccaccatctcaacaagagcaaggtcattctgtccattcatct
tctatggtcttgaggactctgaaccatccactaggtggtgaattttcagaagctcctttg
tcaacatctgttccatctgaaacaacgtctgataatttacagataaccacccaaccttct
gatggtctagaggaaaaacttgattctgatgacccttctgtgaaggaactggatgttaaa
gaccttgagggggttgaagtcaaagacttagatgatgaagatcttgaaaacttaaattta
gatacagaggatggcaaggtagttgaattggatactttagataatttggaaactaatgat
cccaacctggatgacctcttaaggtcaggagagtttgatatcattgcatatacagatcca
gaacttgacatgggagataagaaaagcatgtttaatgaggaactagaccttccaattgat
gataagttagataatcagtgtgtatctgttgaaccaaaaaaaaaggaacaagaaaacaaa
actctggttctctctgataaacattcaccacagaaaaaatccactgttaccaatgaggta
aaaacggaagtattgtctccaaattctaaggtggaatccaaatgtgaaactgaaaaaaat
gatgagaataaagataatgttgacactccttgctcacaggcttctgctcactcagaccta
aatgatggagaaaagacttctttgcatccttgtgatccagatctatttgagaaaagaacc
agtcgagaaactgctggccccggtggaaatgtcattcaagcatccactcaactacctgct
caagatgtaataaactcttgtggcataactggatcaactccagttctctcgagtttactt
gctaatgagaaatctgataattcagacattaggccattggggtctccaccaccaccaact
ctgccggcctcaccatccaatcatgtgtcaagtttgcctcctttaatagcaccgcctggc
cgtgttttggataataccatgaattctaatgtaacagtagtctctagggtaaaccatgtt
ttttctcagggtgtgcaggtaaatccaggattcattccaggtcaatcaacagttaaccac
aatctggggacaggaaaacctacaactcaaactgggcctctaacaagtcagtctggtacc
agtagcatgtctggaccccaacagctaatgattcctcaaacattagcacagcagaataga
gagaggccccttcttctagaagaacagcctctacttctacaggatcttttggatcaagaa
aggcaagaacagcagcagcaaagacagatgcaagccatgattcgtcagcgatcagaaccg
ttcttccctaatattgattttgatgcaattacagatcctataatgaaagccaaaatggtg
gcccttaaaggcataaataaagtgatggcacaaaacaatctgggcatgccaccaatggtg
atgagcaggttcccttttatgggccaggcggtaactggaacacagaatggtgaaggacag
aaccttggaccacaggccattcctcaggatggcagtataacacatcagatttctaggcct
aatcctccaaattttggtccaggctttgtcaatgattcacagcgtaagcagtatgaagag
tggctccaggagacccaacagctgcttcaaatgcagcagaagtatcttgaagaacaaatt
ggtgctcacagaaaatctaagaaggccctttcagctaaacaacgtactgccaagaaagct
gggcgtgaatttccagaggaagatgcagaacaactcaagcatgttactgaacagcaaagc
atggttcagaaacagctagaacagattcgtaaacaacagaaagaacatgctgaattgatt
gaagattatcggatcaaacagcagcagcaatgtgcaatggccccacctaccatgatgccc
agtgtccagccccagccacccctaattccaggtgccactccacccaccatgagccaaccc
gcctttcccatggtgccacagcagcttcagcaccagcagcacacaacagttatttctggc
catactagccctgttagaatgcccagtttacctggatggcaacccaacagtgctcctgcc
cacctgcccctcaatcctcctagaattcagcccccaattgcccaattaccaataaaaact
tgtacaccagccccagggacagtctcaaatgcaaatccacagagtggaccaccacctcgg
gtagaatttgatgacaacaatccctttagtgaaagttttcaagaacgggaacgtaaggaa
cgtttacgagaacagcaagagagacagcggatccaactcatgcaggaggtagatagacaa
agagctttgcagcagaggatggaaatggagcaacatggcatggtgggctctgagataagt
agtagtaggacatctgtgtcccagatttccttctacagttccgacttaccttgtgatttt
atgcaacctctaggaccccttcagcagtctccacaacaccaacagcaaatggggcaggtt
ttacagcagcagaatatacaacaaggatcaattaattcaccctccacccaaactttcatg
cagactaatgagcgaaggcaggtaggccctccttcatttgttcctgattcaccatcaatc
cctgttggaagcccaaatttttcttctgtgaagcagggacatggaaatctttctgggacc
agcttccagcagtccccagtgaggccttcttttacacctgctttaccagcagcacctcca
gtagctaatagcagtctcccatgtggccaagattctactataacccatggacacagttat
ccgggatcaacccaatcgcttattcagttgtattctgatataatcccagaggaaaaaggg
aaaaagaaaagaacaagaaagaagaaaagagatgatgatgcagaatccaccaaggctcca
tcaactccccattcagatataactgccccaccgactccaggcatctcagaaactacctct
actcctgcagtgagcacacccagtgagcttcctcaacaagccgaccaagagtcggtggaa
ccagtcggcccatccactcccaatatggcagcaggccagctatgtacagaattagagaac
aaactgcccaatagtgatttctcacaagcaactccaaatcaacaggcatacgcaaattca
gaaatagataagctctccatggaaacccctgccaaaacagaagagataaaactggaaaag
gctgagacagagtcctgcccaggccaagaggagcctaaattggaggaacagaatggtagt
aaggtagaaggaaacgctgtatcctgtcctgtctcctcagcacagagtcctccccattct
gctgggacccctgctgccaaaggagactcagggaatgaacttctgaaacacttgttgaaa
aataaaaagtcatcttctcttttgaatcaaaaacctgagggcagtatttgttcagaagat
gactgtacaaaggataataaactagttgagaagcagaacccagctgaaggactgcaaact
ttgggggctcaaatgcaaggtggttttggatgtggcaaccagttgccaaaaacagatgga
ggaagtgaaaccaagaaacagcgaagcaaacggactcagaggacgggtgagaaagcagca
cctcgctcaaagaaaaggaaaaaggacgaagaggagaaacaagctatgtactctagcact
gacacgtttacccacttgaaacagcagaataatttaagtaatcctccaacaccccctgcc
tctcttcctcctacaccacctcctatggcttgtcagaagatggccaatggttttgcaaca
actgaagaacttgctggaaaagccggagtgttagtgagccatgaagttaccaaaactcta
ggacctaaaccatttcagctgcccttcagaccccaggatgacttgttggcccgagctctt
gctcagggccccaagacagttgatgtgccagcctccctcccaacaccacctcataacaat
caggaagaattaaggatacaggatcactgtggtgatcgagatactcctgacagttttgtt
ccctcatcctctcctgagagtgtggttggggtagaagtgagcaggtatccagatctgtca
ttggtcaaggaggagcctccagaaccggtgccgtcccccatcattccaattcttcctagc
actgctgggaaaagttcagaatcgagaaggaatgacataaaaactgagccgggcacttta
tattttgcgtcaccttttggtccttccccaaatggtcccagatcaggtcttatatctgta
gcaattactctgcatcctacagctgctgagaacattagcagtgttgtggctgcgttttcc
gaccttcttcacgtccgaatccctaacagctatgaggttagcaatgctccagatgtccca
tccatgggtttggtcaatagccacagaatcaacccgggtttggagtatcgacagcattta
cttctccgtgggcctccgccaggatctgcaaaccctcccagattagtgagctcttaccgg
ctgaagcagcctaatgtaccatttcctccaacaagcaatggtctttctggatataaggat
tctagtcatggtattgcagaaagcgcagcactcagaccacagtggtgttgtcattgtaaa
gtggttattcttggaagtggtgtgcggaaatctttcaaagatctgacccttttgaacaag
gattcccgagaaagcaccaagagggtagagaaggacattgtcttctgtagtaataactgc
tttattctttattcatcaactgcacaagcgaaaaactcagaaaacaaggaatccattcct
tcattgccacaatcacctatgagagaaacgccttccaaagcatttcatcagtacagcaac
aacatctccactttggatgtgcactgtctcccccagctcccagagaaagcttctccccct
gcctcaccgcccatcgccttccctcctgcttttgaagcagcccaagtcgaggccaaacca
gatgagctgaaggtgacagtcaagctgaagcctcggctaagagctgtccatggtgggttt
gaagattgcaggccgctcaataaaaaatggagaggaatgaaatggaagaagtggagcatt
catattgtaatccctaaggggacatttaaaccaccttgtgaggatgaaatagatgaattt
ctaaagaaattgggcacttcccttaaacctgatcctgtgcccaaagactatcggaaatgt
tgcttttgtcatgaagaaggtgatggattgacagatggaccagcaaggctactcaacctt
gacttggatctgtgggtccacttgaactgcgctctgtggtccacagaggtctatgagact
caggctggtgccttaataaatgtggagctagctctgaggagaggcctacaaatgaaatgt
gtcttctgtcacaagacaggtgccactagtggatgccacagatttcgatgcaccaacatt
tatcactttacttgcgccattaaagcacaatgcatgttttttaaggacaaaactatgctt
tgccccatgcacaaaccaaagggaattcatgagcaagaattaagttactttgcagtcttc
aggagggtctatgttcagcgcgatgaggtgcgacagattgctagcatcgtgcaacgagga
gaacgggaccatacctttcgcgtgggtagcctcatcttccacacaattggtcagctgctt
ccacagcagatgcaagcattccattctcctaaagcactcttccctgtgggctatgaagcc
agccggctgtactggagcacgcgctatgccaataggcgctgccgctacctgtgctccatc
gaggagaaggatgggcgcccagtgtttgtcatcaggattgtggaacaaggccatgaagac
ctggttctaagtgacatctcacctaaaggtgtctgggataagattttggagcctgtggcg
tgtgtgagaaaaaagtctgaaatgctccagcttttcccagcgtatttaaaaggagaggat
ctgtttggcctgaccgtctctgcagtggcacgcatagcggaatcactacctggggttgag
gcatgtgaaaattataccttccgatacggccgaaatcctctcatggaacttcctcttgcc
gttaaccccacaggttgtgcccgttctgaacctaaaatgagtgcccatgtcaagaggttt
gtgttaaggcctcacaccttaaacagcaccagcacctcaaagtcatttcagagcacagtc
actggagaactgaacgcaccttatagtaaacagtttgttcactccaagtcatcgcagtac
cggaagatgaagactgaatggaaatccaatgtgtatctggcacggtctcggattcagggg
ctgggcctgtatgctgctagagacattgagaagcacaccatggtcattgagtacatcggg
actatcattcgaaacgaagtagcaaacagaaaagagaaactttatgagtctcagaaccgt
ggtgtgtacatgttccgcatggacaacgatcacgtgattgacgcaacgctcacaggaggg
cctgcaaggtatatcaaccattcgtgtgcacctaattgtgtggctgaagtggtgactttt
gagagaggacacaaaattatcatcagctccaatcggagaatccagaaaggagaagagctc
tgctatgactataagtttgactttgaagatgaccagcacaagattccgtgtcactgtgga
gctgtgaactgccggaagtggatgaactga

DBGET integrated database retrieval system