KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134639Help
Entry
101134639         CDS       T02442                                 

Gene name
ART4
Definition
ecto-ADP-ribosyltransferase 4
Orthology
K06717  
ADP-ribosyltransferase 4 [EC:2.4.2.31]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     101134639 (ART4)
Cellular antigens [BR:ggo04090]
 Proteins
  101134639 (ART4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 329 aa AA seqDB search
MKLQGQRRSTCDTSKWGPLINRCKKILLPTTVPPATMRIWLLGGLLPFLLLLSGLQRPTE
GSEVAIKIDFDFAPGSFDDQYQGCSKQVMEKLTQGDYFTKDIEAQKNYFRMWQKAHLAWF
NQGKVLPQNMTTTHAVAILFYTLNSNVRSDFTRAMASVARTPQQYERSFHFKYLHYYLTS
AIQLLRKDSIMENGTLCYEVHYRTKDVHFNAYTGATIRFGQFLSTSLLKEEAQEFGNQTL
FTIFTCLGAPVQYFSLKKEVLIPPYELFKVINMSYQPRGNWLQLRSTGNLSTYNCQLLKA
SSKKCIPDPIAIASLSFLTSVIIFSKSRV
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcaagggcaaaggagaagtacttgtgacacaagcaaatggggtccattgatc
aacagatgcaagaagattcttctcccaactactgtacctcctgcaacgatgagaatctgg
ctcctaggaggcctgctgccattcctgctgctcctctctggcctgcagagacccacagag
ggttctgaggttgcaattaaaatcgactttgacttcgcaccaggttcttttgatgatcag
taccaaggctgtagcaaacaggttatggagaaactaactcaaggggattatttcacaaaa
gacatagaagcccagaagaattattttaggatgtggcaaaaagcccacttagcctggttt
aaccaaggaaaagttctaccccagaacatgactaccacacacgctgtggctattttgttt
tatacattgaacagcaatgttcgttctgactttactagagccatggcctctgttgccagg
actccacagcagtatgaacgttcattccacttcaaatatttacactactacctcacctca
gcaatccagctgctgaggaaagacagcatcatggagaatggcactctgtgctatgaggtg
cattataggacgaaggatgtccacttcaatgcctacacaggggccaccattcgatttggc
caattcctctccacatccctcctgaaagaagaggcacaggagtttgggaaccagacacta
tttaccatattcacctgcctgggtgcacctgtacagtacttctccctcaagaaggaagtc
ttgatccctccctatgagctgtttaaagttataaatatgagctaccaaccaagaggaaac
tggttgcagttgaggtcaactgggaacctgagcacatataactgtcagctgctaaaagct
tccagcaagaaatgcatccctgatcctatagctattgcatctctctcctttttgaccagt
gtcatcatcttttccaaaagcagagtataa

DBGET integrated database retrieval system