KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134917Help
Entry
101134917         CDS       T02442                                 

Gene name
CTRB2
Definition
chymotrypsinogen B2
Orthology
K01310  
chymotrypsin [EC:3.4.21.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.1  chymotrypsin
     101134917 (CTRB2)
Peptidases [BR:ggo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101134917 (CTRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
16
AA seq 263 aa AA seqDB search
MAFLWLLSCWALLGTAFGCGVPTIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVRND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCKGDSGGPLVCQKDGAWTLVGIVSWGSRTCST
TTPAVYARVTKLIPWVQKILAAN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atggctttcctctggctcctctcctgctgggccctcctgggtaccgccttcggctgcggg
gtccccaccatccaccctgtgctcagcggcctgtccaggatcgtgaatggggaggacgcc
gtccccggctcctggccctggcaggtgtccctgcaggacaaaaccggcttccacttctgt
gggggctccctcatcagcgaggactgggtagtcaccgccgcccactgcggggtcaggacc
tccgacgtggtcgtggctggggagtttgaccagggctctgacgaggagaacatccaggtc
ctgaagatcgccaaggtcttcaagaaccccaagttcagcattctgacagtgcgcaatgac
atcacgctgctgaagctggccacacctgcccgcttctcccagacagtgtccgccgtgtgc
ctgcccagcgccgacgatgacttccccgcggggacactgtgtgccaccacaggctggggc
aagaccaagtacaatgccaacaagacccctgacaagctgcagcaggcagccctgcccctc
ctgtccaatgccgaatgcaagaagtcctggggcaggaggatcaccgacgtgatgatctgt
gccggggccagtggcgtctcctcctgcaagggtgactctggaggccccctggtctgccag
aaggacggagcctggaccctggtgggcattgtgtcctggggcagccgcacctgctctacc
accacgcccgctgtgtacgcccgtgtcaccaagctcataccctgggtgcagaagatcctg
gccgccaactga

DBGET integrated database retrieval system