KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134931Help
Entry
101134931         CDS       T02442                                 

Gene name
DOT1L
Definition
histone-lysine N-methyltransferase, H3 lysine-79 specific
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101134931 (DOT1L)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    101134931 (DOT1L)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101134931 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 1537 aa AA seqDB search
MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGP
EGKVAGPTDAPMDSGAEEEKAGAATVKKPSPSKARKKKLNKKGRKMAGRKRGRPKKMNTA
NPERKPKKNQTALDALHAQTVSQTVASSPQDAYRSPHSPFYQLPPSVQRHSPNPLLVAPT
PPALQKLLESFKIQYLQFLAYTKTPQYKASLQELLGQEKEKNAQLLGAAQQLLSHCQAQK
EEIRRLFQQKLDELGVKALTYNDLIQAQKEISAHNQQLREQSEQLEQDNRALRGQSLQLL
KARCEELQLDWATLSLEKLLKEKQALKSQISEKQRHCLELQISIVELEKSQRQQELLQLK
SCVPPDDALSLHLRGKGALGRELEPDASRLHLELDCTKFSLPHLSSMSPELSMNGQAAGY
ELCGALSRPSSKQNTPQYLASPLDQEVVPCTPSHVGRPRLEKLSGLAAPDYTRLSPAKIV
LRRHLSQDHTVPGRPAVSELHSRAEHTKENGLPYQSPSVPGSMKLSPQDPRPLSPGALQL
AGEKSSEKGLRERAYGSSGELITSLPISIPLSTVQPNKLPVSIPLASVVLPSRAERARST
PSPVLQPRDPSSTLEKQIGANAHGAGSRSLALAPAGFSYAGSVAISGALAGSPASLTPGA
EPATLDESSSSGSLFATVGSRSSTPQHPLLLAQPRNSLPASPAHQLSSSPRLGGAAQGPP
PEAGKGDLPSDSGFSDPESEAKRRIVFTITTGAGSAKQSPSSKHSPLTASARGDCVPSHG
QDSRKRGRRKRASAGTPSLSAGVSPKRRALPSVAGLFTQPSGSPLNLNSMVSNINQPLEI
TAISSPETSLKSSPVPYQDHDQPPVLKKERPLSQTNGAHYSPLTSDEEPGSEDEPSSARI
ERKIATISLESKSPPKTLENGGGLAGRKPTPAGEPVNSSKWKSTFSPISDIGLAKSADSP
LQASSTLSQNSLFTFRPALEEPSADAKLAAHPRKGFPGSLSGADGLSPGTNPANGCTFGG
GLAADLSLHSFSDGASLPHKGPEAAGLSSPLSFPSQRGKEGSDANPFLSKRQLDGLAGLK
GEGSRGKEAGEGGLPLCGPTDKTPLLTGKAAKARDRELDLKNGHNLFISAAAVPPGSLLS
GPGLAPAASSAGGAASSAQTHRSFLGPFPPGPQFALGPMSLQANLGSVAGSSVLQSLFSS
VPAAAGLVHVSSAATRLTNSHAMGSFSGVAGGTVGGN
NT seq 4614 nt NT seq  +upstreamnt  +downstreamnt
atgggggagaagctggagctgagactgaagtcgcccgtgggggctgagcccgccgtctac
ccgtggccgctgccggtctacgataaacatcacgatgctgctcatgaaatcatcgagacc
atccgatgggtctgtgaagaaatcccggatctcaagctcgctatggagaattacgtttta
attgactatgacaccaaaagcttcgagagcatgcagaggctctgcgacaagtacaaccgt
gccatcgacagcatccaccagctgtggaagggcaccacgcagcccatgaagctgaacacg
cggccgtccactggactcctgcgccatatcctgcagcaggtctacaaccactcggtgacc
gaccccgagaagctcaacaactatgagcccttctcccccgaggtgtacggggagacctcc
ttcgacctggtggcccagatgattgacgagatcaagatgaccgacgacgacctgtttgtg
gacttggggagcggtgtgggccaggtcgtgctccaggttgctgctgccaccaactgcaaa
catcactatggcgtcgagaaagcagacatcccggccaagtatgcggagaccatggaccgc
gagttcaggaagtggatgaaatggtatggaaaaaagcatgcagaatacacattggagaga
ggcgatttcctctcagaagagtggagggagcgaatcgccaacacgagtgttatatttgtg
aataattttgcctttggtcctgaggtggatcaccagctgaaggagcggtttgcaaacatg
aaggaaggtggcagaatcgtgtcctcgaaacccttcgcacctctgaacttcagaataaac
agtagaaacttgagtgacatcggcaccatcatgcgcgtggtggagctctcgcccctgaag
ggctcggtgtcgtggacggggaagccagtctcctactacctgcacactatcgaccgcacc
atacttgaaaactatttttctagtctgaaaaacccaaaactcagggaggaacaggaggca
gcccggcgccgccagcagcgcgagagcaagagcaacgcggccacgcccactaagggccca
gagggcaaggtggccggccccaccgacgcccccatggactctggtgctgaggaagagaag
gcgggagcagccaccgtgaagaagccgtctccctccaaagcccgcaagaagaagctaaac
aagaaggggaggaagatggctggccgcaagcgcgggcgccccaagaagatgaacactgcg
aatcccgagcggaagcccaagaagaaccaaactgcactggatgccctgcacgctcagacc
gtgtctcagacggtggcctcctcaccccaggatgcctacagatcccctcacagcccgttc
taccagctacctccgagcgtgcagcggcactcccccaacccgctgctggtggcgcccacc
ccgcccgcgctgcagaagctgctagagtccttcaagatccagtacctgcagttcctggca
tacacaaagaccccccagtacaaggccagcctgcaggagctgctgggccaggagaaggag
aagaatgcccagctcctgggcgcggctcagcagctcctcagccactgccaggcccagaag
gaggagatcaggaggctgttccagcaaaaattggatgagctgggcgtgaaggcgctgacc
tacaacgacctgattcaagcgcagaaggagatctccgcccataaccagcagctgcgggag
cagtcggagcagctggagcaggacaaccgcgcgctccgcggccagagcttgcagctgctc
aaggctcgctgcgaggagctgcagctggactgggccacgctgtcgctggagaagctcttg
aaggagaagcaggccctgaagagccagatctcggagaagcagaggcactgcctggagctg
cagatcagcatcgtggagctagagaagagccagcggcagcaggagctcctgcagctcaag
tcctgtgtgccgcctgacgacgccctgtccctgcacctgcgtgggaagggcgccctgggc
cgcgagctggagcctgacgccagccggctgcacctggagctggactgcaccaagttctcg
ctgcctcacttgagcagcatgagcccggagctctccatgaacggccaggctgctggctat
gagctctgcggtgcgctgagccggccttcgtcgaagcagaacacgccccagtacctggcc
tcacccctggaccaggaggtggtgccctgtacccctagccacgtcggccggccgcgcctg
gagaagctgtctggcctagccgcacccgactacactaggctgtccccggccaagattgtg
ctgaggcggcacctgagccaggaccacacggtgcccggcaggccggccgtcagtgagctg
cattcgagagctgagcacaccaaggagaacggccttccctaccagagccccagcgtgcct
ggcagcatgaagctgagccctcaggacccgcggcccctgtcccctggggccttgcagctt
gctggagagaagagcagtgagaagggcctgagagagcgcgcctacggcagcagcggggag
ctcatcaccagcctgcccatcagcatcccgctcagcaccgtgcagcccaacaagctcccg
gtcagcatccccctggccagcgtggtgctgcccagccgcgccgagagggcgaggagcacc
cccagtcccgtgctgcagccccgtgacccctcgtccacacttgaaaagcagattggtgct
aatgcccacggtgctgggagcagaagccttgccctggcccccgcaggcttctcctacgct
ggctcggtggctatcagcggggccttggcgggcagcccggcctctctcacacctggagcc
gagccggccaccttggatgagtcctccagctctgggagcctttttgccaccgtggggtcc
cgcagctccacgccacagcaccccctgctgctggcacagccccggaactcgcttccggcc
tctcccgcccaccagctctcctccagtccccggcttggtggggccgcccagggcccaccg
cccgaggccggcaagggggacctgccctccgattccggcttctcagaccctgagagtgaa
gccaagaggaggattgtgttcaccatcaccactggtgcgggcagtgccaagcagtcgccc
tccagcaagcacagccccctgaccgccagcgcccgtggggactgcgtgccaagccacggg
caggacagccgcaagcgcggccggcggaagcgagcatctgcggggacgcccagcttgagc
gcaggcgtgtcccccaagcgccgagccctgccgtccgtcgctggccttttcacacagcct
tcggggtctcccctcaacctcaactccatggtcagtaacatcaaccagcccctggagatt
acagccatctcgtccccggagacctccctgaagagctcccctgtgccctaccaggaccac
gaccagccccccgtgctcaagaaggagcggcctctgagccagaccaatggggcacactac
tccccactcacctcagacgaggagccaggctctgaggacgagcccagcagtgctcgaatt
gagagaaaaattgcaacaatctccttagaaagcaaatctcccccgaaaaccttggaaaat
ggtggtggcttggcgggaaggaagcccacgcccgccggcgagccagtcaatagcagcaag
tggaagtccaccttctcgcccatctccgacatcggcctggccaagtccgcagacagcccg
ctgcaggccagctccaccctcagccagaactccctgttcacgttccggcccgccctggag
gagccctctgccgatgccaagctggccgctcaccccaggaaaggctttcccggctccctg
tcgggggctgacggactcagcccgggcaccaaccctgccaacggctgcaccttcggcggg
ggcctggccgcggacctgagtttacacagcttcagtgatggtgcttctcttccccacaag
ggccccgaggcggccggcctgagctccccgctgagcttcccctcgcagcgcggcaaggag
ggctcggacgccaaccctttcctgagcaagaggcagctggacggcctggctgggctgaag
ggcgagggcagccgcggcaaggaggcaggggagggcggcctaccgctgtgcgggcccacg
gacaagaccccactgctgaccggcaaggccgccaaggcccgggaccgcgagctcgacctc
aagaatggccacaacctcttcatctctgcggcggccgtgcctcccggaagcctcctcagc
ggccccggcctggccccggcggcgtcctctgcaggcggcgcggcgtcctccgcccagacg
caccggtccttcctgggccccttcccgccgggaccgcagttcgcgctcggccccatgtcc
ctgcaggccaacctcggctctgtggccggctcctccgtgctgcagtcgctgttcagctct
gtgccggccgccgcaggcctggtgcacgtgtcgtccgctgccaccagactgaccaactca
cacgccatgggcagcttttccggggtggcaggcggcacagttggaggtaactag

DBGET integrated database retrieval system