KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135156Help
Entry
101135156         CDS       T02442                                 

Gene name
UGT2B7
Definition
UDP-glucuronosyltransferase 2B7 isoform 1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101135156 (UGT2B7)
   00053 Ascorbate and aldarate metabolism
    101135156 (UGT2B7)
   00500 Starch and sucrose metabolism
    101135156 (UGT2B7)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101135156 (UGT2B7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101135156 (UGT2B7)
   00860 Porphyrin and chlorophyll metabolism
    101135156 (UGT2B7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101135156 (UGT2B7)
   00982 Drug metabolism - cytochrome P450
    101135156 (UGT2B7)
   00983 Drug metabolism - other enzymes
    101135156 (UGT2B7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101135156 (UGT2B7)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101135156 (UGT2B7)
Glycosyltransferases [BR:ggo01003]
 Others
  Hydrophobic molecule
   101135156 (UGT2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDAVSNKKFMKKVQESRFDVIFADAMFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADMWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDALGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHVKARGAAVRVDFNTM
SSTDLLNALNTVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
RDLTWFQYHSLDVIGFLLACVATVIFIVTKCCLFCFWKFARKAKKGKND
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattttgctaatacaactgagcttttgctttagctct
gggaattgtggaaaggtgctggtgtgggcagcagaatatagccattggatgaatataaag
acaatcctggatgagcttattcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaaatttatcccacatct
ttaactaaaactgagttggagaatttcatcatgcaacagattaagagatggtcagacctt
ccaaaagatacattttggttatatttttcacaagtacaggaaatcatgtcaatatttggt
gacataactagaaagttctgtaaagatgcagtttcaaataagaaatttatgaaaaaagta
caagagtcaagatttgacgtcatttttgcagatgctatgtttccctgtagtgagctgctg
gctgagctgtttaacataccctttgtgtacagtctcagcttctctcctggctacactttt
gaaaagcatagtggaggatttattttccctccttcctacgtacctgttgttatgtcagaa
ttaactgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttacttt
gacttttggttcgaaatatttgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacatgtggcttattcgaaac
tcctggaattttcagtttccatatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctgcctaaggaaatggaggagtttgtacagagctctgga
gaaaatggtgttgtggtattttctctggggtcaatggtcagtaacatgacagaagaaagg
gccaacgtaattgcatcagcccttgcccagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatgccttaggtctcaatactcggctctacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccaatggcatc
tacgaggcaatctaccatgggatccctatggtgggcattccattgtttgccgatcaacct
gataacattgctcacgtgaaggccaggggagcagctgttagagtggacttcaacacaatg
tcgagtacagacttgctgaatgcactgaacacagtaattaatgatccttcatataaggag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcgggttgcagcc
cgtgacctcacctggttccagtaccactctttggacgtgattgggttcctgctggcctgt
gtggcaactgtgatatttatcgtcacaaaatgttgtctgttttgtttctggaagtttgct
agaaaagcaaagaagggaaaaaatgattag

DBGET integrated database retrieval system