KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135912Help
Entry
101135912         CDS       T02442                                 

Gene name
POR
Definition
NADPH--cytochrome P450 reductase
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     101135912 (POR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 680 aa AA seqDB search
MINMGDSHMDTSSTVSEAVAEEVSLFSMTDMILFSLIVGLLTYWFLFRKKKEEVPEFTKI
QTLTSSVRESSFVEKMKKTGRNIIVFYGSQTGTAEEFANRLSKDAHRYGMRGMSADPEEY
DLADLSSLPEIENALVVFCMATYGEGDPTDNAQDFYDWLQETDVDLSGVKFAVFGLGNKT
YEHFNAMGKYVDKRLEQLGAQRIFELGLGDDDGNLEEDFITWREQFWPAVCEHFGVEATG
EESSIRQYELVVHTDIDAAKVYMGEMGRLKSYENQKPPFDAKNPFLAAVTTNRKLNQGTE
RHLMHLELDISDSKIRYESGDHVAVYPANDSALVNQLGKILGADLDVVMSLNNLDEESNK
KHPFPCPTSYRTALTYYLDITNPPRTNVLYELAQYASETSEQELLRKMASSSGEGKELYL
SWVVEARRHILAILQDCPSLRPPIDHLCELLPRLQARYYSIASSSKVHPNSVHICAVVVE
YETKAGRINKGVATNWLRAKEPAGENGGRALVPMFVRKSQFRLPFKATTPVIMVGPGTGV
APFIGFIQERAWLRQQGKEVGETLLYYGCRRSDEDYLYREELVQFHRDGALTQLNVAFSR
EQSHKVYVQHLLKRDREHLWKLIEGGAHIYVCGDARNMARDVQNTFYDIVAELGAMEHTQ
AVDYIKKLMTKGRYSLDVWS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgatcaacatgggggactcccacatggacaccagctccaccgtgtccgaggcggtggcc
gaagaagtatctctttttagcatgacagacatgattctgttttcgctcatcgtgggtctc
ctaacctactggttcctcttcagaaagaaaaaagaagaagtccctgagttcaccaaaatt
cagacattgacctcctctgtcagagagagcagctttgtggaaaagatgaagaaaacgggg
aggaacatcatcgtgttctacggctcccagacggggactgcagaggagtttgccaaccgc
ctgtccaaggacgcccaccgctacgggatgcgaggcatgtcagcggaccctgaggagtat
gacctggccgacctgagcagcctgccagagatcgagaacgccctggtggttttctgcatg
gccacctacggtgagggagaccccactgacaatgcccaggacttctacgactggctgcag
gagacagacgtggatctctctggggtcaagttcgcggtgtttggtcttgggaacaagacc
tacgagcacttcaatgccatgggcaagtacgtggacaagcggctggagcagctcggcgcc
cagcgcatctttgagctagggttgggcgacgacgatgggaacttggaggaggacttcatc
acctggcgagagcagttctggccggccgtgtgtgaacactttggggtggaagccactggc
gaggagtccagcattcgccagtacgagcttgtggtccacaccgacatagacgcggccaag
gtgtacatgggggagatgggccggctgaagagctacgagaaccagaagcccccctttgat
gccaagaatccgttcctggctgcagtcaccaccaaccggaagctgaaccagggaaccgag
cgccacctcatgcacctggaattggacatctcggactccaaaatcaggtatgaatctggg
gaccacgtggctgtgtacccagccaacgactctgcactcgtcaaccagctgggcaaaatc
ctgggtgccgacctggacgtcgtcatgtccctgaacaacctggatgaggagtccaacaag
aagcacccattcccatgccctacgtcctaccgcacggccctcacctactacctggacatc
accaacccgccacgcaccaacgtgctgtacgagctggcgcagtacgcctcggagacctcg
gagcaggagctgctgcgcaagatggcctcctcctccggcgagggcaaggagctgtacctg
agctgggtggtggaggcccggaggcacatcctggccatcctgcaggactgcccgtccctg
cggccccccatcgaccacctgtgtgagctgctgccgcgcctgcaggcccgctactactcc
atcgcctcatcctccaaggtccaccccaactctgtgcacatctgtgcagtggttgtggag
tacgagaccaaggccggccgcatcaacaagggcgtggccaccaactggctgcgggccaag
gagcctgccggggagaacggcggccgtgcgctggtgcccatgttcgtgcgcaagtcccag
ttccgcctgcccttcaaggccaccacgcctgtcatcatggtgggccccggcaccggggtg
gcacccttcataggcttcatccaggagcgggcctggctgcgacagcagggcaaggaggtg
ggggagacgctgctgtactacggctgccgccgctcggatgaggactacctgtaccgggag
gagctggtgcagttccacagggacggcgcgctcacccagctcaacgtggccttctcccgg
gagcagtcccacaaggtctacgtccagcacctgctaaagcgagaccgagagcacctgtgg
aagttgatcgaaggcggtgcccacatctacgtctgtggggatgcacggaacatggccagg
gatgtgcagaacaccttctacgacatcgtggctgagctcggggccatggagcacacgcag
gcggtggactacatcaagaaactgatgaccaagggccgctactccctggacgtgtggagc
tag

DBGET integrated database retrieval system