KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135980Help
Entry
101135980         CDS       T02442                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 2A3
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00040  Pentose and glucuronate interconversions
ggo00053  Ascorbate and aldarate metabolism
ggo00140  Steroid hormone biosynthesis
ggo00830  Retinol metabolism
ggo00860  Porphyrin and chlorophyll metabolism
ggo00980  Metabolism of xenobiotics by cytochrome P450
ggo00982  Drug metabolism - cytochrome P450
ggo00983  Drug metabolism - other enzymes
ggo01100  Metabolic pathways
ggo05204  Chemical carcinogenesis
Module
ggo_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101135980
   00053 Ascorbate and aldarate metabolism
    101135980
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101135980
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101135980
   00860 Porphyrin and chlorophyll metabolism
    101135980
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101135980
   00982 Drug metabolism - cytochrome P450
    101135980
   00983 Drug metabolism - other enzymes
    101135980
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101135980
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101135980
Glycosyltransferases [BR:ggo01003]
 Others
  Hydrophobic molecule
   101135980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 101135980
NCBI-ProteinID: XP_004038800
Ensembl: ENSGGOG00000009595
UniProt: G3R2C5
Position
4
AA seq 527 aa AA seqDB search
MRSDKSALVFLLLQLFCVGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSK
PVLVDYRKPSALKFEVVHMPQDRTEDTEIFVDLALNVLPGLPTWQSVIKLNDFFVEIRGT
LKMMCESFIYNQTLMKKLQETNYDVMLIDPVIPCGDLMAELLAVPFVLTLRISVGGNMER
SCGKLPAPLSYVPVPMTGLTDRMTFLERVKNSMLSVFFHFWIQDYDYHFWEEFYSKALGR
PTTLCETVGKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKEMENFVQSSGED
GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTRLYDWIPQNDL
LGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTS
EDLLRALRTVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHD
LTWFQHYSIDVIGFLLACVATAIFLFTKCFLFSCQKFNKTRKIEKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgacaagtcagctttggtatttctgctcctgcagctcttctgtgttggctgt
ggattctgtgggaaagtcctggtgtggccctgtgacatgagccattggcttaatgtcaag
gtcattctagaagagctcatagtgaggggccatgaggtaacagtgttgactcactcaaag
cctgtgttagttgactacaggaagccttctgcattgaaatttgaggtggtccatatgcca
caggacagaacagaagacactgaaatatttgttgacctagctctgaatgtcttgccaggc
ttaccaacctggcaatcagttataaaattaaatgatttttttgttgaaataagaggaact
ttaaaaatgatgtgtgagagctttatctacaatcagacgcttatgaagaagctacaggaa
accaactacgatgtaatgcttatcgaccctgtgattccctgtggagacctgatggctgag
ttgcttgcagtcccttttgtgctcacacttagaatttctgtaggaggcaatatggagcga
agctgtgggaaacttccagctccactttcctatgtacctgtgcctatgacaggactaaca
gacagaatgacctttctggaaagagtaaaaaattcaatgctttcagttttcttccacttc
tggattcaggattacgactatcatttttgggaagagttttatagtaaggcattaggaagg
cccactacattatgtgagactgtgggaaaagctgagatatggctaatacgaacatattgg
gattttgaatttcctcaaccataccaacctaactttgagtttgttggaggattgcactgt
aaacctgccaaagctttgcctaaggaaatggaaaattttgtgcagagttcaggggaagat
ggtattgtggtgttttctctggggtcactgtttcaaaatgttacagaagaaaaggctaat
atcattgcttcagcccttgcccagatcccacagaaggtgttatggaggtacaaaggaaaa
aaaccatccacattaggagccaatactcggctgtatgattggataccccagaatgatctt
cttggtcatcccaaaaccaaagcttttatcactcatggtggaatgaatgggatctatgaa
gctatttaccatggggtccctatggtgggagttcccatatttggtgatcagcttgataac
atagctcacatgaaggccaaaggagcagctgtagaaataaacttcaaaactatgacaagc
gaagatttactgagggctttgagaacagtcattaccgattcctcttataaagagaatgct
atgagattatcaagaattcaccatgatcaacctgtaaagcccctagatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcacctgcgatcagctgcccatgac
ctcacctggttccagcactactctatagatgtgattgggttcctgctggcctgtgtggca
actgctatattcttgttcacaaaatgttttttattttcctgtcaaaaatttaataaaact
agaaagatagaaaagagggaatag

DBGET integrated database retrieval system