KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135980Help
Entry
101135980         CDS       T02442                                 

Definition
UDP-glucuronosyltransferase 2A3-like isoform 1
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101135980
   00053 Ascorbate and aldarate metabolism
    101135980
   00500 Starch and sucrose metabolism
    101135980
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101135980
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101135980
   00860 Porphyrin and chlorophyll metabolism
    101135980
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101135980
   00982 Drug metabolism - cytochrome P450
    101135980
   00983 Drug metabolism - other enzymes
    101135980
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101135980
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101135980
Glycosyltransferases [BR:ggo01003]
 Others
  Hydrophobic molecule
   101135980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 527 aa AA seqDB search
MRSDKSALVFLLLQLFCVGCGFCGKVLVWPCDMSHWLNVKVILEELIVRGHEVTVLTHSK
PVLVDYRKPSALKFEVVHMPQDRTEETEIFVDLALNVLPGLPTWQSVIKLNDFFVEIRGT
LKMMCESFIYNQTLMKKLQETNYDVMLIDPVIPCGDLMAELLAVPFVLTLRISVGGNMER
SCGKLPAPLSYVPVPMTGLTDRMTFLERVKNSMLSVFFHFWIQDYDYHFWEEFYSKALGR
PTTLCETVGKAEIWLIRTYWDFEFPQPYQPNFEFVGGLHCKPAKALPKEMENFVQSSGED
GIVVFSLGSLFQNVTEEKANIIASALAQIPQKVLWRYKGKKPSTLGANTRLYDWIPQNDL
LGHPKTKAFITHGGMNGIYEAIYHGVPMVGVPIFGDQLDNIAHMKAKGAAVEINFKTMTS
EDLLRALRTVITDSSYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRSAAHD
LTWFQHYSIDVIGFLLACVATAIFLFTKCFLFSCQKFNKTRKIEKRE
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctgacaagtcagctttggtatttctgctcctgcagctcttctgtgttggctgt
ggattctgtgggaaagtcctggtgtggccctgtgacatgagccattggcttaatgtcaag
gtcattctagaagagctcatagtgaggggccatgaggtaacagtgttgactcactcaaag
cctgtgttagttgactacaggaagccttctgcattgaaatttgaggtggtccatatgcca
caggacagaacagaagaaactgaaatatttgttgacctagctctgaatgtcttgccaggc
ttaccaacctggcaatcagttataaaattaaatgatttttttgttgaaataagaggaact
ttaaaaatgatgtgtgagagctttatctacaatcagacgcttatgaagaagctacaggaa
accaactacgatgtaatgcttatcgaccctgtgattccctgtggagacctgatggctgag
ttgcttgcagtcccttttgtgctcacacttagaatttctgtaggaggcaatatggagcga
agctgtgggaaacttccagctccactttcctatgtacctgtgcctatgacaggactaaca
gacagaatgacctttctggaaagagtaaaaaattcaatgctttcagttttcttccacttc
tggattcaggattatgactatcatttttgggaagagttttatagtaaggcattaggaagg
cccactacattatgtgagactgtgggaaaagctgagatatggctaatacgaacatattgg
gattttgaatttcctcaaccataccaacctaactttgagtttgttggaggattgcactgt
aaacctgccaaagctttgcctaaggaaatggaaaattttgtgcagagttcaggggaagat
ggtattgtggtgttttctctggggtcactgtttcaaaatgttacagaagaaaaggctaat
atcattgcttcagcccttgcccagatcccacagaaggtgttatggaggtacaaaggaaaa
aaaccatccacattaggagccaatactcggctgtatgattggataccccagaatgatctt
cttggtcatcccaaaaccaaagcttttatcactcatggtggaatgaatgggatctatgaa
gctatttaccatggggtccctatggtgggagttcccatatttggtgatcagcttgataac
atagctcacatgaaggccaaaggagcagctgtagaaataaacttcaaaactatgacaagc
gaagatttactgagggctttgagaacagtcattaccgattcctcttataaagagaatgct
atgagattatcaagaattcaccatgatcaacctgtaaagcccctagatcgagcagtcttc
tggatcgagtttgtcatgcgccacaaaggagccaagcacctgcgatcagctgcccatgac
ctcacctggttccagcactactctatagatgtgattgggttcctgctggcctgtgtggca
actgctatattcttgttcacaaaatgttttttattttcctgtcaaaaatttaataaaact
agaaagatagaaaagagggaatag

DBGET integrated database retrieval system