KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135987Help
Entry
101135987         CDS       T02442                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase
  KO
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
AMPK signaling pathway
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    101135987 (EEF2K)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    101135987 (EEF2K)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     101135987 (EEF2K)
Protein kinases [BR:ggo01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   101135987 (EEF2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
ENSGGOG00000015267
Position
16
AA seq 761 aa AA seqDB search
MADEDLIFRLEGVDGGQSPRAGHDGDSDGDSDDEEGYFICPITDDPSSNQNVNSKVNKYY
SNLTKSERYSSSGSPANSFHFKEAWKHAIQKAKHMPDPWAEFHLEDIATERATRHRYNAV
TGEWLDDEVLIKMASQPFGRGAMRECFRTKKLSNFLHAQQWKGASNYVAKRYIEPVDRDV
YFEDVRLQMEAKLWGEEYNRHKPPKQVDIMQMCIIELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNIRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTETGTDFGDGNL
GVRGMALFFYSHACNRICESMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLRPLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDN
MASRDHDHLDNHREGQAGSREEGWTSSQERFLGRSLSLWITVISSSVQGHSYSNRKYESD
EDSLGSSGRVCVEKWNLLNSSRLHLPRASAVALEVQRLNALDLEKKIGKSILGKVHLAMV
RYHEGGRFCEKGEEWDQESAVFHLEHAADLGELEAIVGLGLMYSQLPHHILADVSLKETE
ENKTKGFDYLLKAAEAGDRQSMILVARAFDTGQNLSPDRYCSCHPGGAGRNLGCRWALVL
GISTGLGSSLGCPMTSPATVGNLFYLPGLSFFILQGVLLGRVMGDTGLAKTTGGSSLFAP
LCCLSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAWAQMEE
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atggcagacgaagatctcatcttccgcctggaaggcgttgatggcggccagtccccccga
gctggccatgatggtgattccgatggggacagcgacgatgaggaaggttacttcatctgc
cccatcacggatgacccaagctcgaaccagaatgtcaattccaaggttaataagtactac
agcaacctaacaaaaagtgagcggtatagctccagcgggtccccggcaaactccttccac
ttcaaggaagcctggaagcacgcaatccagaaggccaagcacatgcccgacccctgggct
gagttccacctggaagatattgccaccgaacgtgctactcgacacaggtacaatgccgtc
accggggaatggctggatgatgaagttctgatcaagatggcatctcagcccttcggccga
ggagcaatgagggagtgcttccggacgaagaagctctccaacttcttgcatgcccagcag
tggaagggagcctccaactacgtggcgaagcgctacatcgagcccgtagaccgggatgtg
tactttgaggacgtgcgtctacagatggaggccaagctctggggggaggagtataatcgg
cacaagccccccaagcaggtggacatcatgcagatgtgcatcatcgagctgaaggacaga
ccaggcaagcccctcttccacctggagcactacatcgagggcaagtacatcaagtacaac
tccaactctggctttgtccgcgatgacaacatccgcctgacgccgcaggccttcagccac
ttcacttttgagcgttctggccatcagctgatagtggtggacatccagggagttggggat
ctctacactgacccacagatccacacggagacgggcactgactttggagacggcaaccta
ggtgtccgcgggatggcgctcttcttctactctcatgcctgcaaccggatttgcgagagc
atgggccttgctccctttgacctctcgccccgggagagggatgcggtgaatcagaacacc
aagctgctgcaatcagccaagaccatcttgagaggaacagaggaaaaatgtgggagcccc
cgagtaaggaccctctctgggagccggccacccctgctccgtcccctttcagagaactct
ggagacgagaacatgagcgacgtgaccttcgactctctcccttcttccccatcttcggcc
acaccacacagccagaagctagaccacctccattggccagtgttcagtgaccttgataac
atggcatccagagaccatgatcatctagacaaccaccgggagggccaggctggttccagg
gaggagggctggaccagctctcaggagaggttcctgggaagaagcttgtcgctttggatc
actgtaatttcttcctccgttcagggccactcatacagtaatcggaagtacgagtctgac
gaagacagcctgggcagctctggacgggtatgtgtagagaagtggaatctcctcaactcc
tcccgcctccacctgccgagggcttcggccgtggccctggaagtgcaaaggcttaatgct
ctggacctcgaaaagaaaatcgggaagtccattttggggaaggtccatctggccatggtg
cgctaccacgagggtgggcgcttctgtgagaagggcgaggagtgggaccaggagtctgct
gtcttccacctggagcacgcagccgacctgggcgagctggaggccatcgtgggcctggga
ctcatgtactcgcagttgcctcatcacatcctagccgatgtctctctgaaggagacagaa
gagaacaaaaccaaaggatttgattacttactaaaggccgctgaagctggcgacaggcag
tccatgatcctagtggcgcgagcttttgacactggccagaacctcagcccggacaggtac
tgcagctgtcacccaggaggagctggtaggaacctgggctgcaggtgggcgcttgtcctc
ggtatcagcacaggcctgggttccagtcttggctgccccatgaccagtccagcaaccgtg
ggcaacttattttacctccctggcctcagtttcttcatattgcagggtgttcttctggga
agggtgatgggggacactgggctggcaaaaacaacaggtggttcatctctttttgccccc
ctttgctgtctttcaggggacttgtatacccaggcagcagaggcagcgatggaagccatg
aagggccgactggccaaccagtactaccaaaaggctgaagaggcctgggcccagatggag
gagtaa

DBGET integrated database retrieval system