KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136145Help
Entry
101136145         CDS       T02442                                 

Gene name
NCOA3
Definition
nuclear receptor coactivator 3
Orthology
K11256  
nuclear receptor coactivator 3 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Thyroid hormone signaling pathway
Class
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:ggo04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 1417 aa AA seqDB search
MSGLGENLDPLATDSRKRKLPCDTPGQGLTCSGEKRRREQESKYIEELAELISANLSDID
NFNVKPDKCAILKETVRQIRQIKEQGKTISNDDDVQKADVSSTGQGVIDKDSLGPLLLQA
LDGFLFVVNRDGNIVFVSENVTQYLQYKQEDLVNTSVYNILHEEDRKDFLKNLPKSTVNG
VSWTNETQRQKSHTFNCRMLMKTPHDILEDINASPEMRQRYETMQCFALSQPRAMMEEGE
DLQSCMICVARRITTGERAFPSNPESFITRHDLSGKVVNIDTNSLRSSMRPGFEDIIRRC
IQRFFSLNDGQSWSQKRHYQEAYLNGHAETPVYRFSLADGTIVTAQTKSKLFRNPVTNDR
HGFVSTHFLQREQNGYRPNPNPVGQGIRPPMAGCNSSVGGMSMSPNQGLQMPSSRAYGLA
DPSTTGQMSGARYGGSSNIASLTPGPGMQSPSSYQNNNYGLNMSSPPHGSPGLAPNQQNI
MISPRNRGSPKIASHQFSPVAGVHSPMASSGNTGNHSFSSSSLSALQAISEGVGTSLLST
LSSPGPKLDNSPNMNITQPSKVSNQDSKSPLGFYCDQNPVESSMCQSNSRDHLSDKESKE
SSVEGAENQRGPLESKGHKKLLQLLTCSSDDRGHSSLTNSPLDSSCKESSVSVTSPSGVS
SSTSGGVSSTSNMHGSLLQEKHRILHKLLQNGNSPAEVAKITAEATGKDTSSITSCGDGN
VVKQEQLSPKKKENNALLRYLLDRDDPSDALSKELQPQVEGVDNKMSQCTSSTIPSSSQE
KDPKIKTETSEEGSGDLDNLDAILGDLTSSDFYNNSISSNGSHLGTKQQVFQGTNSLGLK
SSQSVQSIRPPYNRAVSLDSPVSVGSSPPVKNISAFPMLPKQPMLGGNPRMMDSQENYGS
SMGGPNRNVTVTQTPSSGDWGLPNSKASRMEPMNSNSMGRPGGDYNTSLPRPALGGSIPT
LPLRSNSIPGARPVLQPQQQQQQMLQMRPGEIPMGMGANPYGQAAASNQLGSWPDGMLSV
EQVPHGTQNRPLLRNSLDDLVGPPSNLEGQSDERALLDQLHTLLSNTDATGLEEIDRALG
IPELVNQGQALEPKQDAFQGQEAAVMMDQKAGLYGQTYPAQGPPMQGGFHLQGQSPSFNS
MMNQMNQQGNFPLQGMHPRANIMRPRTNTPKQLRMQLQQRLQGQQFLNQSRQALELKMEN
PTAGGAAVMRPMMQPQQGFLNAQMVAQRSRELLSHHFRQQRVAMMMQQQQQQQQQQQQQQ
QQQQQQQQQTQAFSPPPNVTASPSMDALLAGPTMPQAPPQQFPYQPNYGMGQQPDPAFGR
VSSPPNAIMSSRMGPSQNPMMQHPQAASIYQSSEMKGWPSGNLARNSSFSQQQFAHQGNP
AVYSMVHMNGSSGHMGQMNMNPMPMSGMPMGPDQKYC
NT seq 4254 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattaggagaaaacttggatccactggccactgattcacgaaaacgcaaattg
ccatgtgataccccagggcaaggtcttacctgcagtggtgaaaagcggagacgggagcag
gaaagtaaatatattgaagaattggctgagctgatatctgccaatcttagtgatattgac
aatttcaatgtcaaaccagataaatgtgcgattttaaaggaaacagtaagacagatacgt
caaataaaagagcaaggaaaaactatttccaatgatgatgatgttcaaaaagccgatgta
tcttctacagggcagggagttattgataaagactccttaggaccgcttttacttcaggca
ttggatggttttctatttgtggtgaatcgagacggaaacattgtatttgtatcagaaaat
gtcacacaatacctgcaatataagcaagaggacctggttaacacaagtgtttacaatatc
ttacatgaagaagacagaaaggattttcttaaaaatttaccaaaatctacagttaatgga
gtttcctggacaaatgagacccaaagacaaaaaagccatacatttaattgccgtatgttg
atgaaaacaccacatgatattctggaagacataaacgccagtcctgaaatgcgccagaga
tatgaaacaatgcagtgctttgccctgtctcagccacgagctatgatggaggaaggggaa
gatttgcaatcttgtatgatctgtgtggcacgacgcattactacaggagaaagagcattt
ccatcaaaccctgagagctttattaccagacatgatctttcaggaaaggttgtcaatata
gatacaaattcactgagatcctccatgaggcctggctttgaagatataatccgaaggtgt
attcagagattttttagtctaaatgatgggcagtcatggtcccagaaacgtcactatcaa
gaagcttatcttaatggccatgcagaaaccccagtatatcgattctcgttggctgatgga
actatagtgactgcacagacaaaaagcaaactcttccgaaatcctgtaacaaatgatcga
catggctttgtctcaacccacttccttcagagagaacagaatggatatagaccaaaccca
aatcctgttggacaagggattagaccacctatggctggatgcaacagttcagtaggcggc
atgagtatgtcgccaaaccaaggcttacagatgccgagcagcagggcctatggcttggca
gaccctagcaccacagggcagatgagtggagctaggtatgggggttccagtaacatagct
tcattgacccctgggccaggcatgcaatcaccatcttcctaccagaacaacaactatggg
ctcaacatgagtagccccccacatgggagtcctggtcttgccccaaaccagcagaatatc
atgatttctcctcgtaatcgtgggagtccaaagatagcctcacatcagttttctcctgtt
gcaggtgtgcactctcccatggcatcttctggcaatactgggaaccacagcttttccagc
agctctctcagtgccctgcaagccatcagtgagggtgtggggacttcccttttatctact
ctgtcatcaccaggccccaaattggataactctcccaatatgaatattacccaaccaagt
aaagtaagcaatcaggattccaagagtcctctgggcttttattgcgaccaaaatccagtg
gagagttcaatgtgtcagtcaaatagcagagatcacctcagtgacaaagaaagtaaggag
agcagtgttgagggggcagagaatcaaaggggtcctttggaaagcaaaggtcataaaaaa
ttactgcagttacttacctgttcttctgatgaccggggtcattcctccttgaccaactcc
cccctagattcaagttgtaaagaatcttctgttagtgtcaccagcccctctggagtctcc
tcctctacatctggaggagtatcctctacatccaatatgcatgggtcactgttacaagag
aagcaccggattttgcacaagttgctgcagaatgggaattcaccagctgaagtagccaag
attactgcagaagccactgggaaagacaccagcagtataacttcttgtggggacggaaat
gttgtcaagcaggagcagctaagtcctaagaagaaggagaataatgcacttcttagatac
ctgctggacagggatgatcctagtgatgcactctctaaagaactacagccccaagtggaa
ggagtggataataaaatgagtcagtgcaccagctccaccattcctagctcaagtcaagag
aaagaccctaaaattaagacagagacaagtgaagagggatctggagacttggataatcta
gatgctattcttggtgatctgactagttctgacttttacaataattccatatcctcaaat
ggtagtcatctggggactaagcaacaggtgtttcaaggaactaattctctgggtttgaaa
agttcacagtctgtgcagtctattcgtcctccatataaccgagcagtgtctctggatagc
cctgtttctgttggctcaagtcctccagtaaaaaatatcagtgctttccccatgttacca
aagcaacccatgttgggtgggaatccaagaatgatggatagtcaggaaaattatggctca
agtatgggtgggccaaaccgaaatgtgactgtgactcagactccttcctcaggagactgg
ggcttaccaaactcaaaggccagcagaatggaacctatgaattcaaactccatgggaaga
ccaggaggagattataatacttctttacccagacctgcactgggtggctctattcccacg
ttgcctcttcggtctaatagcataccaggtgcgagaccagtattgcagccgcagcaacag
cagcagcagatgcttcaaatgaggcctggtgaaatccccatgggaatgggggctaatccc
tatggccaagcagcagcatctaaccaactgggttcctggcccgatggcatgttgtccgtg
gaacaagttcctcatggcactcaaaataggcctcttcttaggaattccctggatgatctt
gttgggccaccttccaacctggaaggccagagtgacgaaagagcattattggaccagctg
cacactcttctcagcaacacagatgccacaggcctggaagaaattgacagagctttgggc
attcctgaacttgtcaatcagggacaggcattagagcccaaacaggatgctttccaaggc
caagaagcagcagtaatgatggatcagaaggcaggattatatggacagacatacccagca
caggggcctccaatgcaaggaggctttcatcttcagggacaatcaccatcttttaactct
atgatgaatcagatgaaccagcaaggcaattttcctctccaaggaatgcacccgcgagcc
aacatcatgagaccccggacaaacacccccaagcaacttagaatgcagcttcagcagagg
ctgcagggccagcagtttttgaatcagagccgacaggcacttgaattgaaaatggaaaac
cctactgctggtggtgctgcggtgatgaggcctatgatgcagccccagcagggttttctt
aatgctcaaatggtcgcccaacgcagcagagagctgctaagtcatcacttccgacaacag
agggtggctatgatgatgcagcagcagcaacagcagcagcagcaacagcagcagcagcag
cagcagcagcaacagcagcagcagcaaacccaggccttcagcccacctcctaatgtgact
gcttcccccagcatggatgcgcttttggcgggacccacaatgccacaagctcctccgcaa
cagtttccatatcaaccaaattatggaatgggacaacaaccagatccagcctttggtcga
gtgtctagtcctcccaatgcaatcatgtcgtcaagaatgggtccctcccagaatcccatg
atgcaacacccgcaggctgcatccatctatcagtcctcagaaatgaagggctggccatca
ggaaatttggccaggaacagctccttttcccagcagcagtttgcccaccaggggaatcct
gcagtgtatagtatggtgcacatgaatggcagcagtggtcacatgggacagatgaacatg
aaccccatgcccatgtctggcatgcctatgggtcctgatcagaaatactgctga

DBGET integrated database retrieval system