KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136267Help
Entry
101136267         CDS       T02442                                 

Gene name
JOSD2
Definition
josephin-2 isoform 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101136267 (JOSD2)
Peptidases [BR:ggo01002]
 Cysteine Peptidases
  Family C86
   101136267 (JOSD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 188 aa AA seqDB search
MSQAPGAQPSPPTVYHERQRLELCAVHALNNVLQQQLFSQEAADEICKRLAPDSRLNPHR
SLLGTGNYDVNVIMAALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLGLLSLP
LRRRHWVALRQVDGVYYNLDSKLRAPEALGDEDGVRAFLAAALAQGLCEVLLVVTKEVEE
KGSWLRTD
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggccccgggagcacagccgagcccacccaccgtgtaccacgaacggcagcgc
ctggagctgtgtgctgtccacgccctcaacaacgttctgcagcagcagctctttagccag
gaggctgccgatgagatctgcaagaggttggccccagactcccggctgaaccctcatcgc
agcctcctgggcaccggcaactatgatgtcaatgtgatcatggccgctctgcaggggctg
ggcctggccgccgtgtggtgggacaggaggaggcccctgtcccagctggccctgccccag
gtactggggctgatcctgaacctgccctcgcccgtgtcgctggggctgctgtcactgccg
ctgcgccggcggcactgggtggccctgcgtcaggtggacggtgtctactacaacctggac
tccaagctgcgggcacccgaggccctgggggatgaggacggagtcagggccttcctggcg
gctgcgctggcccagggcctgtgcgaggtgctgctggtagtgaccaaggaggtggaggag
aagggcagctggctgcggacagactga

DBGET integrated database retrieval system