KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136341Help
Entry
101136341         CDS       T02442                                 

Gene name
GLS
Definition
LOW QUALITY PROTEIN: glutaminase kidney isoform, mitochondrial
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101136341 (GLS)
   00330 Arginine and proline metabolism
    101136341 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101136341 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101136341 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    101136341 (GLS)
   04727 GABAergic synapse
    101136341 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101136341 (GLS)
   05206 MicroRNAs in cancer
    101136341 (GLS)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101136341 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2B
AA seq 663 aa AA seqDB search
MMRLRGSGMLRDLLLRSPAGVSATLRRAQPLVTLCRRPRGGGRPAAGPAAAARLHPWWGG
GGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEG
KELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRLKECMD
MLRLTLQTTSDGVMLDKDLFKNAFCGHYFVVSVNEVVRVMKIYYLSILYLFISFQSFGXV
ADYIPQLAKFSPDLWGVSVCTVDGQRHSTGDTKVPFCLQSCVKPLKYAIAVNDLGTEYVH
RYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKFDYVMQFLNKMA
GNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYFQLCSIEVTCES
ASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFHVGLPAKSGVAG
GILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRHFAKKLDPRREG
GDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAAEGHVEVVKFLL
EACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLD
GLL
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggggatgctgcgggacctgctcctgcggtcgcccgccggc
gtgagcgcgactctgcggcgggcacagccgttggtcaccctgtgccggcgtccccgaggc
gggggacggccggccgcgggcccggctgccgccgcgcgactccacccgtggtggggcggg
ggcggctggccggcggagcccctcgcgcggggcctgtccagctctccttcggagatcttg
caggagctgggcaaggggagcacgcatccgcagcccggggtgtcgccacccgctgccccg
gcggcgcccggccccaaggacggccccggggagacggacgcgtttggcaacagcgagggc
aaagagctggtggcctcaggtgaaaataaaataaaacagggtctgttacctagcttggaa
gatttgctgttctatacaattgcggaaggacaagagaaaatacctgttcataaatttatt
acagcactcaaatctacaggattgcgaacgtctgatcccaggttgaaagagtgtatggat
atgttaagattaactcttcaaacaacgtcagatggtgtcatgctagacaaagatcttttt
aaaaatgctttctgtgggcattattttgttgtatctgtgaatgaagttgttagagtaatg
aaaatatattatttgtcaatattatatctattcatttctttccaatcttttggataggtt
gcagattatattcctcaactggccaaattcagtcccgatttgtggggtgtgtctgtttgt
acagtagatggacagaggcattctactggagataccaaagttcccttctgtcttcagtcc
tgtgtaaaacctttgaaatatgccattgctgttaatgatcttggaactgaatatgtgcat
cgatatgttggaaaagagccgagtggactaagattcaacaaactgtttttgaatgaagat
gacaaaccacataatcctatggtaaatgctggagcaattgttgtgacttcactaataaag
caaggagtaaataatgctgaaaaatttgactatgtcatgcagtttttgaataagatggct
ggtaatgaatatgttggattcagtaatgcaacgtttcagtctgaaagagaaagtggagat
cgaaattttgcaataggatattacttaaaagaaaagaagtgttttccagaaggcacagac
atggttggtatattagacttctacttccagctgtgctccattgaagtgacttgtgaatca
gccagtgtgatggctgcgacactggctaatggtggtttctgcccaattactggtgaaaga
gtactgagccctgaagcagttcgaaatacattgagtttgatgcattcctgtggcatgtat
gacttctcagggcagtttgctttccatgttggtcttcctgcaaaatctggagttgctggg
ggcattcttttagttgtccccaatgttatgggtatgatgtgctggtctcctcctctggat
aagatgggcaacagtgttaagggaattcacttttgtcacgatcttgtttctctgtgtaat
ttccataactatgataatttgagacactttgcaaaaaaacttgatcctcgaagagaaggt
ggtgatcaaagggtaaagtcagtgataaatcttttgtttgctgcatatactggagatgtg
tctgcacttcgaagatttgctttgtcagctatggacatggaacagcgggactatgattct
agaacagcactccatgtagctgctgcagagggtcatgttgaagttgttaaatttttgctg
gaagcctgcaaagtaaaccctttccccaaggacaggtggaataacactcccatggatgaa
gcactgcactttggacaccatgatgtatttaaaattctccaagaataccaagtccagtac
acacctcaaggagattctgacaacgggaaggaaaatcaaaccgtccataagaatcttgat
ggattgttgtaa

DBGET integrated database retrieval system