KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136477Help
Entry
101136477         CDS       T02442                                 

Gene name
SETD7
Definition
histone-lysine N-methyltransferase SETD7
Orthology
K11431  
histone-lysine N-methyltransferase SETD7 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
FoxO signaling pathway
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ggo00310]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:ggo04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 366 aa AA seqDB search
MDSDDEMVEEAVEGHLDDDGLPHGFCTVTYSSTDRFEGNFVHGEKNGRGKFFFFDGSTLE
GYYVDDALQGQGVYTYEDGGVLQGTYVDGELNGPAQEYDTDGRLIFKGQYKDNIRHGVCW
IYYPDGGSLVGEVNEDGEMTGEKIAYVYPDERTALYGKFIDGEMIEGKLATLTSTEEGRP
HFELMPGNSVYHFDKSTSSCISTNALLPDPYESERVYVAESLISSAGEGLFSKVAVGPNT
VMSFYNGVRITHQEVDSRDWALNGNTLSLDEETVIDVPEPYNHVSKYCASLGHKANHSFT
PNCIYDMFVHPRFGPIKCIRTLRAVEADEELTVAYGYDHSPPGKSGPEAPEWYQVELKAF
QATQQK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggatagcgacgacgagatggtggaggaggcggtggaagggcacctggacgatgacgga
ttaccgcacgggttctgcacagtcacctactcctccacagacagatttgaggggaacttt
gttcacggagaaaagaacggacgggggaagttcttcttctttgatggcagcaccctggag
gggtattatgtggatgatgccttgcagggccagggagtttacacttatgaagatggggga
gttctccagggcacgtatgtagacggagagctgaacggtccagcccaggaatatgacaca
gatgggagactgatcttcaaggggcagtataaagataacattcgtcatggagtgtgctgg
atatattacccagatggaggaagccttgtaggagaagtaaatgaagatggggagatgact
ggagagaagatagcctatgtgtaccctgatgagaggaccgcactttatgggaaatttatt
gatggagagatgatagaaggcaaactggctacccttacgtccactgaagaagggaggcct
cactttgaactgatgcctggaaattcagtgtaccactttgataagtctacttcatcttgc
atttctaccaatgctcttcttccagatccttatgaatcagaaagggtttatgttgctgaa
tctctcatttccagtgctggagaaggacttttttcaaaggtagctgtgggacctaatact
gttatgtctttttataatggagttcgaattacacaccaagaggttgacagcagggactgg
gcccttaatgggaacaccctctcccttgatgaagaaacggtcattgatgtgcctgagccc
tataaccacgtatccaagtactgtgcctccttgggacacaaggcaaatcactccttcact
ccaaactgcatctacgatatgtttgtccacccccgttttgggcccatcaaatgcatccgc
accctgagagcagtggaggccgatgaagagctcaccgttgcctatggctatgaccacagc
ccccccgggaagagtgggcctgaagcccctgagtggtaccaggtggagctgaaggccttc
caggccacccagcaaaagtga

DBGET integrated database retrieval system