KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137325Help
Entry
101137325         CDS       T02442                                 

Gene name
GALC
Definition
LOW QUALITY PROTEIN: galactocerebrosidase
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101137325 (GALC)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101137325 (GALC)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     101137325 (GALC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 687 aa AA seqDB search
MAEWLLSASWQRRAKAMTAAAGSAGRAAVPLLLCALLAPGGAYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSQILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYA
LDENYFRGYEWWLMKEAKKRNPNITLIGLPWSFPGWLGKGFDWPYVNLQLTAYYVVTWIV
GAKRYHDLDIDYIGVSNIFKIXFSFGHLFVLRKMLNYQGLQRVKIIASDNLWESISASML
LDAELFKVVDVIGAHYPGTHSAKDAKLTGKKLWSSEDFSTLNSDMGAGCWGRILNQNYIN
GYMTSTIAWNLVASYYEQLPYGRCGLMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYL
KTVGHLEKGGSYVALTDGLGNLTIIIETMSHKHSKCIRPFLPYFNVSQQFATFVLKGSFS
EIPELQVWYTKLGKTSERFLFKQLDSLWLLDSDGSFTLSLHEDELFTLTTLTTGRKGSYP
LPPKSQPFPSTYKDDFNVDYPFFSEAPNFADQTGVFEYFTNIEDPGEHHFTLRQVLNQRP
ITWAADASNTISIIGDYNWTNLTIKCDVYIETPDTGGVFIAGRVNKGGILIRSARGIFFW
IFANGSYRVTGDLAGWIIYALGRVEVTAKKWYTLTLTIKGHFASGMLNDKSLWTDIPVNF
PKNGWAAIGTHSFEFAQFDNFLVEATC
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggctgagtggctactctcggcttcctggcaacgccgagcgaaagctatgactgccgcc
gcgggttcggcgggccgcgccgcggtgcccttgctgctgtgtgcgctgctggcgcccggc
ggcgcgtacgtactcgacgactccgacgggctgggccgggagttcgacggcatcggcgcg
gtcagcggcggcggggcaacctcccgacttctagtaaattacccagagccctatcgttct
cagatattggattatctctttaagccgaattttggtgcctctttgcatatcttaaaagtg
gaaataggtggtgatgggcagacaacagatggcactgagccctcccacatgcactatgca
ctagatgagaattatttccgaggatatgagtggtggttgatgaaagaagctaagaagagg
aatcccaatattacactcattgggttgccatggtcattccctggatggctgggaaaaggt
ttcgactggccttatgtcaatcttcagctgactgcctattatgtcgtgacctggattgtg
ggagccaagcgttaccatgatttggacattgattatattggagttagtaatatatttaaa
atatgattcagttttggacatttgtttgtattaagaaaaatgctgaattatcaaggtctc
cagcgagtgaaaatcatagcaagtgataatctctgggagtccatctctgcatccatgctc
cttgatgccgaactcttcaaggtggttgatgttataggggctcattatcctggaacccat
tcagcaaaagatgcaaagttgactgggaagaagctctggtcttctgaagactttagcact
ttaaatagtgacatgggtgcaggctgctggggtcgcattttaaatcagaattatatcaat
ggctatatgacttccacaatcgcatggaatttagtggctagttactatgaacagttgcct
tatgggagatgcgggttgatgacggcccaggagccatggagtgggcactacgtggtagaa
tctcctgtctgggtatcagctcataccactcagtttactcaacctggctggtattacctg
aagacagttggccatttagagaaaggaggaagctacgtagctctgactgatggcttaggg
aacctcaccatcatcattgaaaccatgagtcataaacattctaagtgcatacggccattt
cttccttatttcaatgtgtcacaacaatttgccacctttgttcttaagggatcttttagt
gaaataccagagctacaggtatggtataccaaacttggaaaaacatccgaaagatttctt
tttaagcagctggattctctatggctccttgacagcgatggcagtttcacactgagcctg
catgaagatgagctgttcacactcaccactctcaccactggtcgcaaaggcagctacccg
cttcctccaaaatcccagcccttcccaagtacctataaggatgatttcaatgttgattac
ccattttttagtgaagctccaaactttgctgatcaaactggtgtatttgaatattttaca
aatattgaagaccctggcgagcatcacttcacgctacgccaagttctcaaccagagaccc
attacgtgggctgccgatgcatccaacacaatcagtattataggagactacaactggacc
aatctgactataaagtgtgatgtttacatagagacccctgacacaggaggtgtgttcatt
gcaggaagagtaaataaaggtggtattttgattagaagtgccagaggaattttcttctgg
atttttgcaaatggatcttacagggttacaggtgatttagctggatggattatatatgct
ttaggacgtgttgaagttacagcaaaaaaatggtatacgctcacgttaactattaagggt
catttcgcctctggcatgctgaatgacaagtctctgtggacagacatccctgtgaatttt
ccaaagaatggctgggctgcaattggaactcactcctttgaatttgcacagtttgacaac
tttcttgtggaagccacatgctaa

DBGET integrated database retrieval system