KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137450Help
Entry
101137450         CDS       T02442                                 

Gene name
MAPK7
Definition
mitogen-activated protein kinase 7 isoform 1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Module
MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101137450 (MAPK7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101137450 (MAPK7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    101137450 (MAPK7)
   04921 Oxytocin signaling pathway
    101137450 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    101137450 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101137450 (MAPK7)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101137450 (MAPK7)
Protein kinases [BR:ggo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101137450 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 814 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVPAPAPAPTPTPAQP
TSPPPGPVAQPTGPQPQPAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATSTS
LLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaagcacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgacggag
tatgtggccacgcgctggtaccgtgcgcccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactatgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgcgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccaccg
tgccctggccctgcacctgacactattgatctgaccctgcagccacctccaccagccagt
gagcctgccccaccaaagaaagagggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagcgcacccctggag
gctcctgaacctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttagaacgctggactcgaatggcccggcccccagcc
ccagcccccacctctgtgccggcccctgccccagcgccaacgccaaccccagcccaacct
accagtcctcctcctggccctgtagcccagcccactggcccgcaaccacaacctgcgggc
tctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccccacccc
actggccctcctgggcccatccctgtccccgcgccaccccagattgccacctccaccagc
ctcctggctgcccagtcacttgtgccaccccctgggctgcctggctccagcaccccagga
gttttgccttacttcccacctggcctgccgcccccagacgccgggggagcccctcagtct
tccatgtcagagtcacctgatgtcaaccttgtgacccagcagctatctaagtcacaggtg
gaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggctacggt
gttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggctgatggg
ccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgactggctc
gaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccagatggac
tccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system