KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137450Help
Entry
101137450         CDS       T02442                                 

Gene name
MAPK7
Definition
mitogen-activated protein kinase 7 isoform 1
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:ggo04010]
Cellular Processes; Cell communication; Gap junction [PATH:ggo04540]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:ggo04912]
Organismal Systems; Endocrine system; Oxytocin signaling pathway [PATH:ggo04921]
Organismal Systems; Nervous system; Neurotrophin signaling pathway [PATH:ggo04722]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:ggo05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 814 aa AA seqDB search
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPASEPAPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVPAPAPAPTPTPAQP
TSPPPGPVAQPTGPQPQPAGSTSGPVPQPACPPPGPAPHPTGPPGPIPVPAPPQIATSTS
LLAAQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAGGAPQSSMSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADGPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgctttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaagcacgacaacatcatcgccatcaaggacatc
ctgaggcccaccgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctgcaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcctgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccctccaacctattggtgaatgagaactgtgagctcaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgacggag
tatgtggccacgcgctggtaccgtgcgcccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactatgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagccgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcctttgaccgcgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccaccg
tgccctggccctgcacctgacactattgatctgaccctgcagccacctccaccagccagt
gagcctgccccaccaaagaaagagggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagcgcacccctggag
gctcctgaacctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggagcga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttagaacgctggactcgaatggcccggcccccagcc
ccagcccccacctctgtgccggcccctgccccagcgccaacgccaaccccagcccaacct
accagtcctcctcctggccctgtagcccagcccactggcccgcaaccacaacctgcgggc
tctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccccacccc
actggccctcctgggcccatccctgtccccgcgccaccccagattgccacctccaccagc
ctcctggctgcccagtcacttgtgccaccccctgggctgcctggctccagcaccccagga
gttttgccttacttcccacctggcctgccgcccccagacgccgggggagcccctcagtct
tccatgtcagagtcacctgatgtcaaccttgtgacccagcagctatctaagtcacaggtg
gaggaccccctgccccctgtgttctcaggcacaccaaagggcagtggggctggctacggt
gttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggctgatggg
ccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgactggctc
gaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccagatggac
tccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system