KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138112Help
Entry
101138112         CDS       T02442                                 

Gene name
TYMP
Definition
thymidine phosphorylase isoform 1
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Bladder cancer
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ggo00240]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:ggo00983]
Human Diseases; Cancers; Bladder cancer [PATH:ggo05219]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
22
AA seq 482 aa AA seqDB search
MAALMTPGTRAPPAPGDFSGEGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAA
VVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGG
VGDKVSLVLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQA
GCCIVGQSEQLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGAA
VFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEEALLCMDGAGPP
DLRDLVTTLGGALLWLSGHAETQAQGAARVAAALDDGSALGRFERMLAAQGVDPGLARAL
CSGSPAERRQLLPRAREQEELLAPADGTVELVRALPLALVLHELGAGRSRAGEPLRLGVG
AELLIDVGQRLHRGTPWLRVHRDGPALSGPQSRALQEALVLSDRAPFTAPSPFAELVLPP
QQ
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcagccttgatgaccccgggaacccgggccccacccgcgcctggtgacttctccggg
gaagggagccagggacttcccgacccttcgccagagcccaagcagctcccggagctgatc
cgcatgaagcgagacggaggccgcctgagcgaagcggacatcaggggcttcgtggccgct
gtggtgaatgggagcgcgcagggcgcacagatcggggccatgctgatggccatccgactt
cggggcatggatctggaggagacctcggtgctgacccaggccctggcccagtcgggacag
cagctggagtggccagaggcctggcgccagcagcttgtggacaagcattccacagggggt
gtgggtgacaaggtcagcctggtcctcgcacctgccctggcggcatgtggctgcaaggtg
ccaatgatcagcggacgtggtctggggcacacaggaggcaccttggataagctggagtct
attcctggattcaatgtcatccagagcccagagcagatgcaagtgctgctggaccaggcg
ggctgctgtatcgtgggtcagagtgagcagctggttcctgcagacggaatcctatatgca
gccagagatgtgacagccaccgtggacagcctgccactcatcacagcctccattctcagt
aagaagctcgtggaggggctgtccgctctggtcgtggacgttaagttcggaggggccgcc
gtcttccccaaccaggagcaggcccgggagctggcaaagacgctggttggcgtgggagcc
agcctagggcttcgggtcgcggcagcgctgaccgccatggacaagcccctgggtcgctgc
gtgggccacgccctggaggtggaggaggcgctgctctgcatggacggcgcaggcccgcca
gacttaagggacctggtcaccacgctcgggggcgccctgctctggctcagcggacacgcg
gagactcaggcccagggcgctgcccgggtggccgcggcgctggacgacggctcggccctt
ggccgcttcgagcggatgctggcggcgcagggcgtggatcccggtctggcccgagccctg
tgctcgggaagtcccgcagagcgccggcagctgctgcctcgcgcccgggagcaggaggag
ctgctggcgcccgcagatggcaccgtggagctggtccgggcgctgccgctggcgctggtg
ctgcacgagctcggggccgggcgcagccgcgctggggagccgctccgcctgggggtgggc
gcagagctgctgatcgacgtgggtcagaggctgcaccgtgggaccccctggctccgcgtg
caccgggacggccccgcgctcagcggcccgcagagccgcgccctgcaggaggcgctcgta
ctctccgaccgtgcgccattcaccgccccttcgcccttcgcagagctcgttctgccgccg
cagcaataa

DBGET integrated database retrieval system