KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138141Help
Entry
101138141         CDS       T02442                                 

Gene name
SCD
Definition
acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    101138141 (SCD)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101138141 (SCD)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    101138141 (SCD)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101138141 (SCD)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101138141 (SCD)
Lipid biosynthesis proteins [BR:ggo01004]
 Desaturase
  First
   101138141 (SCD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 359 aa AA seqDB search
MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETTPLYLEDDIRPDIKDDIYDPTYK
DKEGPSPKVEYVWRNIILMSLLHLGALYGITLIPTCKFYTWLWGVFYYFISALGITAGAH
RLWSHRSYKARLPLRLFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFS
HVGWLLVRKHPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLLMCFILPTLVPWYFWGE
TFQNSVFVATFLRYAVVLNATWLVNSAAHLFGYRPYDKNISPRENILVSLGAVGEGFHNY
HHSFPYDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKAAILARIKRTGDGNYKSG
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacttgctgcaggacgatatctctagctcctataccaccaccaccaccatt
acagcgcctccctccagggtcctgcagaatggaggagataagttggagacgacgcccctc
tacttggaagacgacattcgccctgatataaaagatgatatatatgaccccacctacaag
gataaggaaggcccaagccccaaggttgaatatgtctggagaaacatcatccttatgtct
ctgctacacttgggagccctgtatgggatcactttgattcctacctgcaagttctacacc
tggctttggggggtattctactattttatcagtgccctgggcataacagcaggagctcat
cgtctgtggagccaccgctcttacaaagctcggctgcccctacggctctttctgatcatt
gccaacacaatggcattccagaatgatgtctatgaatgggctcgtgaccaccgtgcccac
cacaagttttcagaaacacatgctgatcctcataattcccgacgtggctttttcttctct
cacgtgggttggctgcttgtgcgcaaacacccagctgtcaaagagaagggcagtacgcta
gacttgtctgacctagaagctgagaaactggtgatgttccagaggaggtactacaaacct
ggcttgctgctgatgtgcttcatcctgcccacgcttgtgccctggtatttctggggtgaa
acttttcaaaacagtgtgttcgttgccactttcttgcgatatgctgtggtgcttaatgcc
acctggctggtgaacagtgctgcccacctcttcggatatcgtccttatgacaagaacatt
agcccccgggagaatatcctggtttcacttggagctgtgggtgagggcttccacaactac
caccactcctttccctatgactactctgccagtgagtaccgctggcacatcaacttcacc
acattcttcattgattgcatggccgccctcggtctggcctatgaccggaagaaagtctcc
aaggccgccatcttggccaggattaaaagaaccggagatggaaactacaagagtggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system