KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138369Help
Entry
101138369         CDS       T02442                                 

Gene name
KAT6A
Definition
histone acetyltransferase KAT6A
Orthology
K11305  
histone acetyltransferase MYST3 [EC:2.3.1.48]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101138369 (KAT6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 2005 aa AA seqDB search
MVKLANPLYTEWILEAIKKVKKQKQRPSEERICNAVSSSHGLDRKTVLEQLELSVKDGTI
LKVSNKGLNSYKDPDNPGRIALPKPRNHGKLDNKQNVDWNKLIKRAVEGLAESGGSTLKS
IERFLKGQKDVSALFGGSAASGFHQQLRLAIKRAIGHGRLLKDGPLYRLNTKATNVDGKE
SCESLSCLPPVSLLPHEKDKPVAEPIPICSFCLGTKEQNREKKPEELISCADCGNSGHPS
CLKFSPELTVRVKALRWQCIECKTCSSCRDQGKNADNMLFCDSCDRGFHMECCDPPLTRM
PKGMWICQICRPRKKGRKLLQKKAAQIKRRYTNPIGRPKNRLKKQNTVSKGPFSKVRTGP
GRGRKRKITLSSQSASSSSEEGYLERIDGLDFCRDSSVSLKFNKKTKGLIDGLTKFFTPS
PDGRKARGEVVDYSEQYRIRKRGNRKSSTSDWPTDNQDGWDGKQENEERLFGSQEIMTEK
DMELFRDIQEQALQKVGVTGPPDPQVRCPSVIEFGKYEIHTWYSSPYPQEYSRLPKLYLC
EFCLKYMKSRTILQQHMKKCGWFHPPANEIYRKNNISVFEVDGNVSTIYCQNLCLLAKLF
LDHKTLYYDVEPFLFYVLTQNDVKGCHLVGYFSKEKHCQQKYNVSCIMILPQYQRKGYGR
FLIDFSYLLSKREGQAGSPEKPLSDLGRLSYMAYWKSVILECLYHQNDKQISIKKLSKLT
GICPQDITSTLHHLRMLDFRSDQFVIIRREKLIQDHMAKLQLNLRPVDVDPECLRWTPVI
VSNSVVSEEEEEEAEEGENEEPQCQERELEISVGKSVSHENKEQDSYSVESEKKPEVMAP
VSSTRLSKQVLPRDSLPANSQPSRRGRWGRKNRKTQERFGDKDSKLLLEETSSAPQEQYG
ECGEKSEDTQEQYTESEEQLVASEEQPSQDGKPDLPKRRLSEGVEPWRGQLKKSPEALKC
RLTEGNERLPCRYSEGDRAVLRGFSESSEEEEEPESPRSSSPPILTKPTLKRKKPFLHRR
RRVRKRKHHNSSVVTETISETTEVLDEPFEDSDSERPMPRLEPTFEIDEEEEEEDENELF
PREYFHRLSSQDVLRCQSSSKRKSKDEEEDEESDDADDTPILKPVSLLRKRDVKNSPLEP
DTSTPLKKKKGWPKGKSRKPIHWKKRPGRKPGFKLSREIMPVSTQACVIEPIVSIPKAGR
KPKIQESEETVEPKEDMPLPEERKEEEEMQAEGEEAEEGEEEDAASSEVPAASPADSSNS
PETETKEPEVEEEEEKPRVSEEQRQSEEEQQELEEPEPEEEEDAAAETAQNDDHDADDED
DGHLESTKKKELEEQPTREDVKEEPGVQESFLDANMQKSREKIKDKEETELDSEEEQPSH
DTSVVSEQMPGSEDDHEEDSHTKEELIELKEEEEIPHSELDLETVQAVQSLTQEESSEHE
GAYQDCEETLAACQTLQSYTQADEDPQMSMVEDCHASEHNSPISSVQSHPSQSVRSVSSP
NVPALESGYTQISPEQGSLSAPSMQNMETSPMMDVPSVSDHSQQVVDSGFSDLGSIESTT
ENYENPSSYDSTMGGSICGNSSSQSSCSYGGLSSSSSLTQSSCVVTQQMASMGSSCSMMQ
QSSVQPAANCSIKSPQSCVVERPPSNQQQQPPPPPPQQPQPPPPQPQPAPQPPPPQQQPQ
QQPPQPQPQQPPPPPPPQQQPPLSQCSMNNSFTPAPMIMEIPESGSTGNISIYERIPGDF
GAGSYSQPSATFSLAKLQQLTNTIMDPHAMPYSHSPAVTSYATSVSLSNTGLAQLAPSHP
LAGTPQAQATMTPPPNLASTTMNLTSPLLQCNMSATNIGIPHTQRLQGQMPVKGHISIRS
KSAPLPSAAAHQQQLYGRSPSAVAMQAGPRALAVQRGMNMGVNLMPTPTYNVNSMNMNTL
NAMNSYRMTQPMMNSSYHSNPAYMNQTAQYPMQMQMGMMGSQAYTQQPMQPNPHGNMMYT
GPSHHSYMNAAGVPKQSLNGPYMRR
NT seq 6018 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactcgcaaacccgctttatactgagtggattttggaggccatcaaaaaagtg
aaaaagcagaaacagcgtccttcagaagaaaggatatgcaatgctgtgtcttcatcccat
ggcttggatcgtaaaactgttttagaacaattggagttgagtgttaaagatggaacaatt
ttaaaagtctcaaataaaggactcaattcctataaagatcctgataatcctgggcgaata
gcacttcctaagcctcggaaccatggaaaattggataataaacaaaatgtggattggaat
aaactgataaagcgggcagttgagggcttggcagagtctggtggctcaactttgaaaagc
attgaacgttttttgaaaggtcagaaggatgtgtctgcattattcggaggcagtgctgcc
tctggttttcaccagcagttacgattggctatcaaacgtgccattggccacggcagactc
cttaaagatggacctctttatcggctcaacactaaagcaaccaacgtggatgggaaagag
agttgtgagtctctttcctgtttacctccagtgtcccttcttccacatgaaaaggataag
ccggttgctgaaccaatccccatctgtagtttctgtcttggtacaaaagaacaaaaccga
gaaaagaagccagaggaactcatctcctgtgccgactgtggcaacagtggccatccatcc
tgtttaaagttttcccctgaactaacggttcgagtgaaggccttacggtggcagtgcatc
gagtgtaaaacatgcagctcctgtcgagatcaaggcaaaaatgcggataacatgctcttt
tgtgattcatgtgaccgaggttttcacatggagtgttgtgatccgccactcacccgtatg
ccaaaaggcatgtggatatgtcaaatatgtcgacctagaaaaaaaggacgaaaacttcta
caaaagaaggcagcacagataaaacggcgctatactaatccaataggacgtccaaaaaac
aggttaaagaaacaaaacacggtatcaaaaggtcccttcagcaaagttcgaactggccct
ggaaggggtaggaaacgaaaaatcactctttccagccaatcagcatcatcatcatcagaa
gaaggatatttagagcggatagatggcttggacttctgcagagatagcagtgtctccttg
aagttcaacaagaaaaccaaagggctcattgatggccttaccaaattttttaccccttcc
cctgatgggcggaaagctcggggggaagtggtggactactccgagcaatatcgaatcaga
aagaggggcaacaggaaatcaagcacttcagattggcccacagacaatcaggatggctgg
gatggcaaacaagaaaatgaggagcggctttttgggagccaggaaatcatgactgagaaa
gatatggaattatttcgtgatatccaagaacaagcactgcagaaagttggagtgactggt
ccccctgatccacaagtccgctgtccctctgtcattgagtttgggaagtatgaaattcac
acctggtactcctccccatatcctcaagaatactcaaggctgcccaaattatatctttgt
gaattttgtctaaaatatatgaaaagtagaactattctgcagcagcacatgaagaaatgt
ggttggttccatcctcctgccaatgagatttacagaaagaataatatttctgtctttgag
gttgatgggaatgtgagtaccatttattgtcaaaacctgtgtctcttggcaaagttgttt
cttgaccacaaaaccctctattacgatgtggagccatttcttttttatgtactaacacag
aatgatgtcaagggctgccaccttgttggctacttttctaaggaaaagcactgccaacag
aagtacaatgtttcctgtataatgattcttcctcaataccagcgtaagggctatggcagg
tttctcatcgatttcagttatttgttatcaaagcgtgaaggccaagcagggtctccagag
aaaccgttatctgatctgggtcgtctttcctacatggcatattggaaaagtgtaatattg
gagtgcctttatcaccaaaatgacaagcagatcagcattaagaagttaagcaagttgact
ggaatctgccctcaagacatcacttccacactccaccacctacgcatgctggacttccgt
agtgaccaatttgtgattatccgccgggaaaaacttatccaggatcacatggcaaagctt
cagctgaatttgcgacctgtagatgtagatccagaatgtttgcgctggactccagtcata
gtatccaactctgtggtctcagaggaggaagaagaggaggctgaggaaggagaaaacgaa
gaaccgcagtgccaggaaagagaattagagatcagtgtgggaaagtctgtgtctcatgag
aacaaagaacaagattcttattcagtagaaagtgaaaagaaaccagaagttatggctcca
gtcagttctacacgtttgagcaaacaagtccttcctcgtgatagtcttcctgcaaatagc
cagccatctcggaggggccgctgggggaggaagaacagaaaaacccaggaacgttttggt
gataaagattctaaactgctcttggaagagacatcttcagctcctcaggaacaatatgga
gaatgtggggagaaatcagaagacacccaggaacaatacactgaaagtgaagaacagctg
gtggcttctgaggagcagccaagccaggacgggaaacctgaccttcccaagagaagactc
agtgagggggttgagccctggcgaggacagctcaagaaaagccctgaggctctgaagtgc
agattaacagaaggaaatgagaggctgccctgtcgctacagtgagggtgacagggctgtc
ctcaggggcttcagtgagagcagcgaggaggaggaggagccggaaagccctcggtcaagc
tcgccaccaattctcacaaagcccacgctgaagcgaaagaaaccatttctccaccgaagg
aggagagtccgaaagcgcaaacaccacaatagcagtgtagtcacagaaactatttctgag
accactgaagtattagatgaaccttttgaagattctgactccgagaggccaatgccaaga
ttagaacccacgtttgagatcgatgaagaagaggaggaagaggatgaaaatgaacttttc
cctagagaatacttccatcgtttgtcttcgcaggatgtactcaggtgtcagtcctcttct
aagaggaagtctaaagatgaagaagaagatgaagagtcagatgatgctgatgacactcct
atcttaaagccagtatctcttttgcgaaaacgtgatgtgaagaattctcctcttgagcca
gatacatccacacctttgaaaaagaaaaagggatggcccaaaggcaagagccgcaaacca
atccactggaagaaaagacctggtcgaaaaccaggatttaagttgagtcgggaaatcatg
ccagtttctactcaagcatgcgtcattgagcccatcgtttccattcctaaagctggacgt
aaacccaagatccaggagagtgaagaaactgttgagccaaaagaagacatgcccctaccc
gaggagaggaaggaggaggaggagatgcaagcagagggagaagaggctgaagagggcgag
gaagaggatgcagccagcagtgaagtcccagcagcctctccagcagacagcagcaatagt
cctgagaccgaaaccaaggagcctgaggtggaggaggaagaagagaagccccgtgtctca
gaggagcagaggcagtcagaggaggagcagcaggagttagaggagccagagccagaggag
gaggaagatgcagctgcagagactgcccagaatgacgaccacgacgctgatgatgaggat
gatggccacctggagtccacaaagaaaaaggagctagaggaacagcccacgagggaagat
gtcaaggaggagcctggtgttcaagagtcttttttagatgctaatatgcagaagagtagg
gaaaagataaaggataaagaggaaaccgagctggattccgaagaggagcagccttcccat
gacacgtccgtggtgtcagagcagatgcctgggtctgaggacgaccacgaagaagactcc
cacactaaggaagagttaatcgaattaaaagaggaggaagagattcctcatagtgagctg
gatctggaaaccgtacaggcagtgcagtctttgactcaagaagaaagcagtgagcatgag
ggcgcctaccaggactgtgaggaaactcttgcggcgtgtcagaccctgcagagttacacc
caggctgacgaggaccctcagatgtccatggttgaagactgtcatgcgtcagaacataat
agccctatctcctctgttcagtctcaccccagccagtcagtccgttcggtcagcagtccc
aacgtgcctgcccttgagagtggctacacccagatcagcccagaacaaggatccctgtcc
gcaccctctatgcagaacatggagaccagccccatgatggatgtgccttccgtatcagac
cactctcagcaggtggtggacagcggcttcagtgacctgggcagcattgagagcaccact
gaaaactatgagaacccgagcagttacgactccacgatgggcggcagcatctgtgggaac
agctcttcccagagcagctgctcctacggtgggctgtcgtcctccagcagcctcacccag
agcagctgtgtggtcactcagcagatggccagcatgggcagcagctgcagcatgatgcag
cagagcagcgtccagcctgctgccaactgcagcatcaagtcacctcagagctgcgtggtg
gagaggcctcccagtaaccagcagcagcagccgccaccaccgcctccacagcagccacag
ccgccgccgccacaaccacaaccagcaccacagcctccaccaccccagcagcagccgcag
cagcagccgccgcagcctcagccccagcagcctccacccccaccccctccccagcagcag
cccccgctgtcacagtgtagtatgaataacagtttcaccccagctcctatgatcatggag
ataccagaatctggaagcactgggaacataagtatctatgagaggattccaggggatttt
ggtgccggcagctactctcaaccatcagccaccttcagcctagccaagctgcagcagctg
accaacaccattatggaccctcatgccatgccttatagccattctcctgctgtgacttcc
tatgcaaccagtgtttctctgtccaatacaggactggctcagctggctccatctcatccc
ttagctgggactcctcaagcacaagccaccatgacgccacccccaaacttggcatccact
accatgaacctcacatctcctctgcttcagtgcaacatgtctgccaccaacattggcatt
cctcacacgcagagattgcaagggcaaatgccagtgaaggggcacatttccatccgctcc
aagtctgcgccactgccctctgcggctgctcaccagcagcagctgtatggccgtagccca
tcggcagttgccatgcaggctggcccgcgcgcactggctgttcagcgtggcatgaacatg
ggggttaatctgatgcctactcccacctataatgtcaattccatgaatatgaacaccttg
aatgccatgaacagctatcgaatgacacagcccatgatgaacagcagttaccatagtaac
cctgcctacatgaaccagacagcacagtatcctatgcagatgcagatgggaatgatgggg
agccaggcctatacccagcagcctatgcagcctaaccctcatgggaacatgatgtacaca
ggcccctcccatcacagctacatgaacgctgctggcgtgcccaagcagtcactcaacgga
ccttacatgagaagatga

DBGET integrated database retrieval system