KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138427Help
Entry
101138427         CDS       T02442                                 

Gene name
UCHL3
Definition
ubiquitin carboxyl-terminal hydrolase isozyme L3 isoform 1
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
13
AA seq 230 aa AA seqDB search
MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVCAVLLLFPITE
KYEVFRTEEEEKIKSQGQDVTSSVYFMKQTISNACGTIGLIHAIANNKDKMHFESGSTLK
KFLEESVSMSPEERARYLENYDAIRVTHETSAHEGQTEAPSIDEKVDLHFIALVHVDGHL
YELDGRKPFPINHGETSDETLLEDAIEVCKKFMERDPDELRFNAIALSAA
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggagggtcaacgctggctgccgctggaggccaatcccgaggtcaccaaccagtttctt
aaacaattaggtctacatcctaactggcaattcgttgatgtatatggaatggatcctgaa
ctccttagcatggtaccaagaccagtctgcgcagtcttacttctctttcctattacagaa
aagtatgaagtattcagaacagaagaggaagaaaaaataaaatctcagggacaagatgtt
acatcatcagtatatttcatgaagcaaacaatcagcaatgcctgtggaacaattggactg
attcatgctattgcaaacaataaagacaagatgcactttgaatctggatcaaccttgaaa
aaattcctggaggaatctgtgtcaatgagccctgaagaacgagccagatacctggagaac
tatgatgccatccgagttactcatgagaccagtgcccatgaaggtcagactgaggcacca
agtatagatgagaaagtagatcttcattttattgcattagttcatgtagatgggcatctc
tatgaattagatgggcggaaaccatttccaattaaccatggtgaaactagtgatgaaact
ttattagaggatgccatagaagtttgcaagaagtttatggagcgtgaccctgatgaacta
agatttaatgcgattgctctttctgcagcatag

DBGET integrated database retrieval system