KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138563Help
Entry
101138563         CDS       T02442                                 

Gene name
P4HB
Definition
protein disulfide-isomerase
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101138563 (P4HB)
Enzymes [BR:ggo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101138563 (P4HB)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   101138563 (P4HB)
  Exosomal proteins of colorectal cancer cells
   101138563 (P4HB)
  Exosomal proteins of bladder cancer cells
   101138563 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 508 aa AA seqDB search
MLRRALLCLAVAALVCADAPEEEDHVLVLRKSNFAEALAAHKYLLVEFYAPWCGHCKALA
PEYAKAAGKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFRNGDTASPKEYTAGR
EADDIVNWLKKRTGPAATTLPDGAAAESLVESSEVAVIGFFKDVESDSAKQFLQAAEAID
DIPFGITSNSDVFSKYQLDKDGVVLFKKFDEGRNNFEGEVTKENLLDFIKHNQLPLVIEF
TEQTAPKIFGGEIKTHILLFLPKSVSDYDGKLSNFKTAAESFKGKILFIFIDSDHTDNQR
ILEFFGLKKEECPAVRLITLEEEMTKYKPESEELTAERITEFCHRFLEGKIKPHLMSQEL
PEDWDKQPVKVLVGKNFEDVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHENI
VIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGAGD
DDDLEDLEEAEEPDMEEDDDQKAVKDEL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgccgcgctctgctgtgcctggccgtggccgccctggtgtgcgccgacgccccc
gaggaggaggaccacgtcttggtgctgcggaaaagcaacttcgcggaggcgctggcggcc
cacaagtacctgctggtggagttctatgccccttggtgtggccactgcaaggctctggcc
cctgagtatgccaaagccgctgggaagctgaaggcagaaggttccgagatcaggttggcc
aaggtggacgccacggaggagtctgacctggcccagcagtacggcgtgcgcggctatccc
accatcaagttcttcaggaatggagacacggcttcccccaaggaatatacagctggcaga
gaggctgatgacatcgtgaactggctgaagaagcgcacaggcccggctgccaccaccctg
cctgacggcgcagctgcagagtccttggtggagtccagtgaggtggctgtcatcggcttc
ttcaaggacgtggagtcggactctgccaagcagtttttgcaggcagcagaggccatcgat
gacataccatttgggatcacttccaacagtgacgtgttctccaaataccagctcgacaaa
gatggggttgtcctctttaagaagtttgatgaaggccggaacaactttgaaggggaggtc
accaaggagaacctgctggactttatcaaacacaaccagctgccccttgtcatcgagttc
accgagcagacagccccgaagatttttggaggtgaaatcaagactcacatcctgctgttc
ttgcccaagagtgtgtctgactatgacggcaaactgagcaacttcaaaacagcagccgag
agcttcaagggcaagatcctgttcatcttcatcgacagcgaccacaccgacaaccagcgc
atcctcgagttctttggcctgaagaaggaagagtgcccggccgtgcgcctcatcaccctg
gaggaggagatgaccaagtacaagcccgaatcggaggagctgacggcagagaggatcaca
gagttctgccaccgcttcctggagggcaaaatcaagccccacctgatgagccaggagctg
ccagaggactgggacaagcagcctgtcaaggtgcttgttgggaaaaactttgaagacgtg
gcttttgatgagaaaaaaaacgtctttgtggagttctatgccccatggtgtggtcactgc
aaacagttggctcccatttgggataaactgggagagacgtacaaagaccatgagaacatc
gtcattgccaagatggactcgactgccaacgaggtggaggccgtcaaagtgcacagcttc
cccacactcaagttctttcctgccagtgccgacaggacggtcatcgattacaacggggaa
cgcacgctggatggttttaagaagttcctggagagcggtggccaggatggggcaggggat
gatgacgatctcgaggacttggaagaagcagaggagccagacatggaggaagacgatgat
cagaaagctgtgaaagatgaactgtaa

DBGET integrated database retrieval system