KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138758Help
Entry
101138758         CDS       T02442                                 

Gene name
SRD5A2
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  
3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Steroid hormone biosynthesis
Prostate cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101138758 (SRD5A2)
 Human Diseases
  Cancers
   05215 Prostate cancer
    101138758 (SRD5A2)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     101138758 (SRD5A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2A
AA seq 254 aa AA seqDB search
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTERLKPAATRLPARAAWFLQELPS
FAVPAGILARQPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLNRGRPYPAILILRGIAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDCILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcaggttcagtgccagcagagcccagtgctggcaggcagcgccactttggtcgccctt
ggggcactggccttgtacgtcgcgaagccctccggctacgggaagcacacggagagattg
aagccggcggctacccgcctgccagcccgcgccgcctggttcctgcaggagctgccttcc
ttcgcggtgcccgcggggatcctcgcccggcagcccctctccctcttcgggccacctggg
acggtacttctgggcctcttctgcgtacattacttccacaggacatttgtgtactcactg
ctcaatcgagggaggccttatccagctatactcattctcagaggcattgccttctgcact
ggaaatggagtccttcaaggctactatctgatttactgtgctgaataccctgatgggtgg
tacacagacatacggtttagcttgggtgtcttcttatttattttgggaatgggaataaac
attcatagtgactgtatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcatttgcatttttctca
ctttgtttccttgggctgcgagcttttcaccaccataggttctacctcaagatgtttgag
gactaccccaaatctcggaaagcccttattccattcatcttttaa

DBGET integrated database retrieval system