KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138786Help
Entry
101138786         CDS       T02442                                 

Gene name
GCH1
Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101138786 (GCH1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     101138786 (GCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 262 aa AA seqDB search
MARGPEPFNAAPSWPEEGATGRPDRVFLTEIPAPGRLPLFGCSNGFPERDPPRPGPSRPA
EKPPRPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILSSLGENPQRQGLLKTPW
RAASAMQFFTKGYQETISVQDIYKIRHNFGHGLPRTLRCEVDWVHIGYLPNKQVLGLSKL
ARIVEIYSRRLQVQERLTKQIAVAITEALRPAGVGVVVEATHMCMVMRGVQKMNSKTVTS
TMLGVFREDPKTREEFLTLIRS
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggggaccggagcccttcaatgcagcgccctcttggcctgaagagggggcgacc
gggcgcccagaccgcgtctttctcactgagatcccagctcctggacgactgcctcttttc
gggtgcagcaatgggttccccgagcgggatccgccgcggcccgggcccagcaggccggcg
gagaagcccccgcggcccgaggccaagagcgcgcagcccgcggacggctggaagggcgag
cggccccgcagcgaggaggataacgagctgaacctccctaacctggcagccgcctactcg
tccatcctgagctcgctgggcgagaacccccagcggcaagggctgctgaagacgccctgg
agggcggcctcggccatgcagttcttcaccaagggctaccaggagaccatctcagttcag
gacatttacaaaattcggcacaattttgggcacgggcttccccggactttgaggtgtgag
gttgattgggtccatattggttatcttcctaacaagcaagtccttggcctcagcaaactt
gcgaggattgtagaaatctatagtagaagactacaagttcaggagcgccttacaaaacaa
attgctgtagcaatcacggaagccttgcggcctgctggagtcggggtagtggttgaagca
acacacatgtgtatggtaatgcgaggtgtacagaaaatgaacagcaaaactgtgaccagc
acaatgttgggtgtgttccgggaggatccaaagactcgggaagagttcctgactctcatt
aggagctga

DBGET integrated database retrieval system