KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138809Help
Entry
101138809         CDS       T02442                                 

Definition
(RefSeq) arachidonate 12-lipoxygenase, epidermal-type-like
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    101138809
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    101138809
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101138809
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    101138809
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     101138809
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
ENSGGOG00000015890
Position
17
AA seq 662 aa AA seqDB search
MGKYTVRVATGDLLLAGSPNLVQLWLVGEHREADLGKQLPPVWGKEAEFEIDVPLHLGRL
LMVKLRKHNVLLSLDWFCKWISVQGPGTQGEAFFXLYRWVQGHGLICLPEGTARTMSDDP
QNLFKKYREQELKERRKVYRWGFWKDGLILPIAGNRQPDLPRDERFLEDKDLDFNVSLAK
GLKDLAIKGTLDFINCVKRLEDFKKIFPHGKTVLAERVYDSWKNDAFFGYQFLSGANPML
LRRSSRLPACLVLPPGMEDLNTQLEKELQAGSLFEVDFSLLDGVKPNVIIFKQQYVAAPL
VMLKLQPVGGLLPMVIQLQPPXHGCPPPLLFLPSDPPMAWLLAKTWVRSSDFQLQQLQSH
LLRGHLIAEVIAVATMRSLPSLHPIYKLLIPHFRYTMVINTLAQSSLVSEWGIFDLVVST
GIGGHVDILQRAMACLTYHSLCPPDDLADRGLLDVKSSFYGQDAIRLWGIISRYVEGMVG
LFYKSDQAVKDDLELQAWCREMTETGLQRAQDQGFLISLESRAQLWHFVTMCIFTCTGQH
ASNHLGQLDWYSWIPNGPCTTRKPPPISKDVTEKDIVDSLPDLHQARMQKTFTKFLGRRQ
PVMVVLGQHEEKYFSGPEPQAVLRQFQEELAAMDKEIEVRNAVLDLPCEYLQPSMVENSV
TI
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagtacacggtccgcgtggccaccggggatttgctcctggcgggctctcccaac
ctggtgcagctgtggctggtgggcgagcaccgggaggcagacctagggaagcagctgcca
ccggtgtggggaaaggaggcagagtttgagatcgacgtccccctgcacctggggcgcctc
ctgatggtgaagctgcgcaaacacaacgtgctgttgagtctcgactggttctgcaagtgg
atctcagtgcagggcccggggacccaaggcgaggcctttttcnacctctaccgctgggtg
cagggccacggacttatctgcctgcctgagggtactgcccggaccatgagtgatgacccc
cagaacctgtttaagaaatatcgggaacaggagctcaaggaaagaaggaaggtgtaccgg
tggggcttctggaaagatgggttaatcctgcctatagcagggaataggcaaccggacctt
cctagggacgagcgattcctcgaggataaggatttagactttaatgtctccctagcgaaa
gggttgaaggacttggccattaaggggacactggatttcataaattgtgtgaaaaggctg
gaagatttcaaaaaaatattcccacatggaaagactgtcctggctgagcgggtttatgat
tcttggaagaatgatgccttctttgggtaccagtttctcagtggtgcaaaccccatgctc
ctgaggcgttcttcaaggctcccagcctgcctggtgctgcctccagggatggaagacttg
aacacccagctggagaaagaactccaggctggatctctgtttgaagtggatttctccttg
ctggatggagtcaagcctaatgtcatcatttttaagcagcaatacgtggcagcccctttg
gtcatgctgaagcttcagcctgttggaggactcttacccatggtcatccagctccagcca
ccttgacacggatgtcccccacctctgctctttctgccctcggatccccccatggcctgg
ctcctggccaagacctgggtccggagctctgatttccagctgcagcagttacagtcacat
ctgctgaggggacacttgattgctgaggttattgctgtggctacaatgagaagcttgcct
agcctccatcctatctacaagctcctgatcccccacttccgctacaccatggtgatcaac
accctggcccagagtagtcttgtctccgaatggggaatttttgacctggtggtgagcact
ggtattggaggccacgtggacattcttcagagagccatggcttgtttgacctatcattcc
ctctgtcctcctgatgacctggctgaccgtgggctcctggatgtgaaatcatctttttat
ggccaagatgccatcaggctgtggggaatcatcagccggtacgtggaggggatggttggg
cttttctacaagagtgaccaagccgtgaaggatgatctagagctgcaggcctggtgcaga
gagatgactgagactggactgcagagggcccaagaccaggggttcctcatctccttagag
tcccgggctcagctctggcactttgtcaccatgtgcatcttcacatgcacaggtcagcat
gcttctaaccacctgggccagctggactggtactcctggatccctaatggcccatgcacc
acgcggaagcccccgcccatctctaaggatgtgacagagaaggatatagtggactcactg
cccgatctccaccaggcacgtatgcaaaagaccttcacaaagttccttggcagacgccag
cctgtcatggtggtcctggggcagcatgaggagaaatatttctctggccctgagccccaa
gctgtgctgagacaattccaggaggaactggctgccatggacaaggagattgaggtccgg
aatgcagtcctggacctgccctgtgagtaccttcaacccagcatggtagagaatagcgtg
accatctga

DBGET integrated database retrieval system