KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138810Help
Entry
101138810         CDS       T02442                                 

Gene name
NLK
Definition
serine/threonine-protein kinase NLK
Orthology
K04468  
nemo like kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
MAPK signaling pathway
FoxO signaling pathway
Wnt signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101138810 (NLK)
   04310 Wnt signaling pathway
    101138810 (NLK)
   04068 FoxO signaling pathway
    101138810 (NLK)
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    101138810 (NLK)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101138810 (NLK)
Protein kinases [BR:ggo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101138810 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 516 aa AA seqDB search
MSLCGARANAKMMAAYNGGTSAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAAA
VHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAAAAPAQVQAAAAAT
VKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSCK
RVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSDH
VKVFLYQILRGLKYLHSXXXVNSNCVLKICDFGLARVEELDESRHMTQEVVTQYYRAPEI
LMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGTPSLEAMRTACEG
AKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAKDALAHPYLDEGR
LRYHTCMCKCCFSTSTGRVYTSDFEPVTNPKFDDTFEKNLSSVRQVKEIIHQFILEQQKG
NRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcgcaagagccaacgcaaaaatgatggcggcttacaatggcggtaca
tctgcagcagcagcaggtcaccaccaccaccatcaccaccaccttccacacctccctcct
cctcacctgcaccaccaccaccaccctcaacaccatcttcatccggggtcggctgccgct
gtacaccctgtacagcagcacacctcttcggcagctgcggcagccgcagcagcggctgca
gctgcagccatgttaaaccctgggcaacaacagccatatttcccatcaccggcaccgggg
caggctcctggaccagctgcagcagccccagctcaggtacaggctgccgcagctgctaca
gttaaggcgcaccatcatcagcactcgcatcatccacagcagcagctggatattgagccg
gatagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaagagat
ggaaagagagtagcgctcaaaaagatgcccaacgtcttccagaatctggtctcttgcaaa
agggtcttccgggaattgaagatgttgtgtttttttaagcatgataatgtactctctgcc
cttgacatactccaacctccacacattgactattttgaagaaatatatgttgtcacagaa
ttgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagatcat
gtcaaagtttttctttatcagattttgcgaggtttgaaatatctccattcannnnnnntt
gtgaacagcaactgtgttctaaagatttgtgattttggattggccagagtggaagaatta
gatgaatcccgtcatatgactcaggaagttgttactcagtattatcgggctccagaaatc
ctgatgggcagccgtcattacagcaatgctattgacatctggtctgtgggatgtatcttt
gcagaactactaggacgaagaatattgtttcaggcacagagtcccattcagcagttggat
ttgatcacggatctgttgggcacaccatcactggaagcaatgaggacagcttgtgaaggc
gctaaggcacatatactcaggggtcctcataaacagccatctcttcctgtactctatacc
ctgtctagccaggctacacatgaagctgttcatctcctttgcaggatgttggtctttgat
ccatccaaaagaatatccgctaaggatgccttagcccacccctacctagatgaagggcga
ctacgatatcacacatgtatgtgtaaatgttgcttttccacctctactggaagagtttat
accagtgactttgagcctgtcaccaatcccaaatttgatgacacttttgagaagaacctc
agttctgtccgacaggttaaagaaattattcatcagttcattttggaacagcagaaagga
aacagagtgcctctctgcatcaaccctcagtctgctgcttttaagagctttattagttcc
actgttgctcagccatctgagatgcccccatctcctctggtgtgggagtga

DBGET integrated database retrieval system