KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139377Help
Entry
101139377         CDS       T02442                                 

Gene name
ALDH1L2
Definition
mitochondrial 10-formyltetrahydrofolate dehydrogenase
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ggo00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 907 aa AA seqDB search
MLRRGSQALRRFSTGRVYFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGK
ADPLALAAEKDGTPVFKLPKWRVKGKTIKEVAEAYRSVGAELNVLPFCTQFIPMDIIDSP
KHGSIIYHPSILPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQRSCDVEPND
TVDALYNRFLFPEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAE
VLHNWIRGHDKVPGAWTEINGQMVTFYGSTLLNSSVPPGEPLEIKGAKKPGLVTKNGLVL
FGNDGKALMVRNLQFEDGKMIPASQYFSTGEMPVVELTAEEVKVAETIKVIWAGILSNVP
IIEDSTDFFKSGASSMDVARLVEEIRQKCGGLQLQNEDVYMATKFEDFIQKVVRKLRGED
QEVELVVDYISKEVNEMMIKMPYQCFINGQFTDADDGKTYDTINPTDGSTICKVSYASLA
DVDKAVAAAKDAFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLAL
KTHIGMSVQTFRYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMM
LAWKSAACLAAGNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSE
HPDIRKLGFTGSTPIGKQIMKRILTSQMMLAIFSLLPLKGMGAVFFNKGENCIAAGRLFV
EESIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCETGVKEGATLVYG
GRQVQRPGFFMEPTVFTDVEDYMYLAKEESFGPIMVISKFQNGDIDGVLQRANSTEYGLA
SGVFTRDINKAMYVSEKLEAGTVFINTYNKTDVAAPFGGVKQSGFGKDLGEEALNEYLKT
KTVTLEY
NT seq 2724 nt NT seq  +upstreamnt  +downstreamnt
atgctgcggcggggcagccaggcgctccggcgcttctccactggccgggtttatttcaaa
aacaagctgaagttggcactaattggccagagcctctttggacaagaagtctatagccac
ctccgcaaagagggccaccgagtagtaggggtgttcacagttccagacaaggatggaaaa
gctgaccctctggctttggctgcagagaaagatgggacccctgtgttcaagcttcctaaa
tggagggtcaagggcaagaccatcaaagaagtggcagaagcctacagatccgtgggtgca
gagctaaatgtgctccctttctgcactcagttcattcccatggatataattgatagtcca
aagcatggctctatcatttatcacccatccatcctgcccaggcacagaggagcctctgct
atcaattggactctaattatgggagataagaaagctgggttttctgttttctgggctgat
gatggcttggatacaggacccatccttcttcagagatcatgtgatgttgaacccaatgat
acagtggatgcactttataatcggtttctttttcctgaaggaatcaaggccatggtagaa
gctgtccaactcatagctgatggaaaagctcctcgtataccccagccagaagaaggggca
acatatgaaggtatccagaaaaaggaaaatgctgagatttcttgggaccagtctgccgaa
gttttacataactggattcgaggtcatgataaagtccctggagcttggacagagataaat
ggacagatggtcactttctatggctcgacattactgaatagctctgtgcctcctggagaa
ccactggaaattaaaggtgccaagaagcctggtctcgttaccaaaaatggacttgttctt
tttggtaacgatggaaaagcactgatggtgagaaatctgcagtttgaagatggaaaaatg
atccctgcctctcagtacttttcaacgggtgagatgccagtggtagaactgacagctgaa
gaggtgaaagtggcagagaccatcaaggtcatctgggctggaattttaagcaatgtcccc
attattgaagactcaacagacttctttaaatctggagcaagctcaatggatgttgccagg
ctggttgaagagatcagacagaaatgtggtgggcttcagttgcagaatgaagatgtctat
atggccaccaagtttgaagactttatccaaaaggtcgtgaggaaactgagaggagaagat
caagaggtggagctggttgtagattatatttcaaaggaggtcaatgaaatgatgataaaa
atgccataccagtgtttcataaatggacagttcacagatgcagacgatggaaagacttac
gacactatcaacccaacagatggatctacaatatgcaaagtatcctacgcttctttggcg
gatgttgataaagcagtagcagcagcaaaagatgcttttgaaaatggtgaatggggaaga
atgaatgcaagagaaagaggaagattgatgtatagacttgcagacctactggaagagaac
caagaagagctggcaactattgaagcccttgattcaggggctgtctataccttggccctg
aagacacacattggaatgtctgtgcaaacattcagatattttgctggctggtgtgacaaa
attcagggttctactattccaatcaaccaggcccgtccaaatcgcaatctgaccttcacc
aagaaagagccactcggtgtctgtgccattattattccctggaactacccgctgatgatg
ctggcatggaagagtgctgcgtgtttggcagcaggcaataccttagtgcttaagccagca
caggtcacgcccttgactgctttgaagtttgcagaactgtctgtgaaagcaggctttcca
aagggggtcatcaacatcattccaggctcaggtggcatagcaggacaacgtctgtctgaa
catcctgacatccgcaaacttggtttcactggttccactcctattggcaaacagatcatg
aagagaatcttgacttctcaaatgatgttagcaatattttctcttctcccactgaagggc
atgggagcagtatttttcaacaaaggagagaactgtattgctgctgggcggttgttcgtg
gaagaatccatccacgacgaatttgtgacaagagtggtagaagaaattaaaaagatgaaa
attggtgatccacttgacagatccactgatcatgggccccaaaatcataaggcccatctg
gaaaagctgctgcaatactgtgaaactggagtgaaagagggggccactttggtgtacggg
ggaagacaagtccaaaggccaggctttttcatggagccgaccgtgttcacagatgtggaa
gactacatgtacctcgccaaagaggaatcctttgggcctattatggtcatttctaaattc
caaaatggggacatcgatggagtgttgcagcgagcaaatagtacagagtatggtttggcc
tcaggggtttttacaagagacataaacaaagctatgtatgtgagtgaaaaactggaagca
ggaactgtttttattaacacatacaacaagacagatgtggcggccccatttggcggagtt
aaacaatctggctttggaaaagacttaggtgaggaagctctaaacgaatatctcaaaacc
aagacggtgacactggaatattag

DBGET integrated database retrieval system