KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139570Help
Entry
101139570         CDS       T02442                                 

Gene name
HDAC9
Definition
histone deacetylase 9 isoform 1
Orthology
K11409  
histone deacetylase 9 [EC:3.5.1.98]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101139570 (HDAC9)
  Substance dependence
   05034 Alcoholism
    101139570 (HDAC9)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101139570 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 562 aa AA seqDB search
MMMPVVDPVVREKQLQQELLLIQQQQQIQKQLLIAEFQKQHENLTRQHQAQLQEHIKLQQ
ELLAIKQQQELLEKEQKLEQQRQEQEVERHRREQQLPPLRGKDRGRERAVASTEVKQKLQ
EFLLSKSATKDTPTNGKNHSVSRHPKLWYTAAHHTSLDQSSPPLSGTSPSYKYTLPGAQD
AKDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGNVVTSFKKRMFEVTESSVSS
SSPGSGPSSPNNGPTGSVTENETSVLPPTPHAEQMVSQQRILIHEDSMNLLSLYTSPSLP
NITLGLPAVPSQLNASNSLKEKQKCETQTLRQGVPLPGQYGGSIPASSSHPHVTLEGKPP
NSSHQALLQHLLLKEQMRQQKLLVAGGVPLHPQSPLATKERISPGIRGAHKLPRHRPLNR
TQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQQIHMNKLLSKSIEQLKQPGSHLEEAEEE
LQGDQAMQEDRAPSSGNSTRSDSSACVDDTLGQVGAVKVKEEPVDSDEDAQIQEMESGEQ
AAFMQQVIGKDLAPGFVIKVII
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgcccgtggtggaccctgttgtccgtgagaagcaattgcagcaggaattactt
cttatccagcagcagcaacaaatccagaagcagcttctgatagcagagtttcagaaacag
catgagaacttgacacggcagcaccaggctcagcttcaggagcatatcaagttgcaacag
gaacttctagccataaaacagcaacaagaactcctagaaaaggagcagaaactggagcag
cagaggcaagaacaggaagtagagaggcatcgcagagaacagcagcttcctcctctcaga
ggcaaagatagaggacgagaaagggcagtggcaagtacagaagtaaagcagaagcttcaa
gagttcctattgagtaaatcagcaacgaaagacactccaactaatggaaaaaatcattcc
gtgagccgccatcccaagctctggtacacggctgcccaccacacatcattggatcaaagc
tctccaccccttagtggaacatctccatcctacaagtacacattaccaggagcacaagat
gcaaaggatgatttcccccttcgaaaaactgcctctgagcccaacttgaaggtgcggtcc
aggttaaaacagaaagtggcagagaggagaagcagccccttactcaggcggaaggatgga
aatgttgtcacttcattcaagaagcgaatgtttgaggtgacagaatcctcagtcagtagc
agttctccaggctctggtcccagttcaccaaacaatgggccaactggaagtgttactgaa
aatgagacttcggttttgccccctacccctcatgctgagcaaatggtttcacagcaacgc
attctaattcatgaagattccatgaacctgctaagtctttatacctctccttctttgccc
aacattaccttggggcttcccgcagtgccatcccagctcaatgcttcgaattcactcaaa
gaaaagcagaagtgtgagacgcagacgcttaggcaaggtgttcctctgcctgggcagtat
ggaggcagcatcccggcatcttccagccaccctcacgttactttagagggaaagccaccc
aacagcagccaccaggctctcctgcagcatttattattgaaagaacaaatgcgacagcaa
aagcttcttgtagctggtggagttcccttacatcctcagtctcccttggcaacaaaagag
agaatttcacctggcattagaggtgcccacaaattgccccgtcacagacccctgaaccga
acccagtctgcacctttgcctcagagcacgttggctcagctggtcattcaacagcaacac
cagcaattcttggagaagcagaagcaataccagcagcagatccacatgaacaaactgctt
tcgaaatctattgaacaactgaagcaaccaggcagtcaccttgaggaagcggaggaagag
cttcagggggaccaggcgatgcaggaagacagagcgccctctagtggcaacagcactagg
agcgacagcagtgcttgtgtggatgacacactgggacaagttggggctgtgaaggtcaag
gaggaaccagtggacagtgatgaagatgctcagatccaggaaatggaatctggggagcag
gctgcttttatgcaacaggtaataggcaaagatttagctccaggatttgtaattaaagtc
attatctga

DBGET integrated database retrieval system