KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139808Help
Entry
101139808         CDS       T02442                                 

Gene name
EHMT2
Definition
(RefSeq) euchromatic histone lysine methyltransferase 2
  KO
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Lysine degradation
Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101139808 (EHMT2)
 Organismal Systems
  Aging
   04211 Longevity regulating pathway - mammal
    101139808 (EHMT2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101139808 (EHMT2)
Chromosome [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101139808 (EHMT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
ENSGGOG00000026532
Position
6
AA seq 1274 aa AA seqDB search
MRGLPRGRGLMRARGRGRAAPPGSRGRGRGGPHRGRGRPRSLLSLPRAQASWTPQLSTGL
TSPPVPCLPSQGEAPAEMGALLLEKETRGATERVHGSLGDTPRSEETLPKATPDSLEPAG
PSSPASVTVTVGDEGADTPVGATPLIGDESENLEGDGDLRGGRILLGHATKSFPSSPSKG
GSCPSRAKMSMTGAGKSPPSVQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRA
RKTMSKPGNGQPPVPEKRPPEVQHFRMSDDVHSLGKVTSDLAKRRKLNSGGGLSEELGSA
RRSGEVTLTKGDPGSLEEWETVVGDDFSLYYDSYSVDERVDSDSKSEVEALTEQLSEEEE
EEEEEEEEEEEEEEEEEEEEDEESGNQSDRSGSSGRRKAKKKWRKDSPWVKPSRKRRKRE
PPRAKEPRGVNGVGSSGPSEYMEVPLGSLELPSEGTLSPNHAGVSNDTSSLETERGFEEL
PLCSCRMEAPKIDRISERAGHKCMATESVDGELSGCNAAILKRETMRPSSRVALMVLCET
HRARMVKHHCCPGCGYFCTAGTFLECHPDFRVAHRFHKACVSQLNGMVFCPHCGEDASEA
QEVTIPRGDGVTPPAGTAAPAPPPLSQDAPGRADTSQPSARMRGHGEPRRPPCDPLADTI
DSSGPSLTLPNGGCLSAVGLPLGPGREALEKALVIQESERRKKLRFHPRQLYLSVKQGEL
QKVILMLLDNLDPNFQSDQQSKRTPLHAAAQKGSVEICHVLLQAGANINAVDKQQRTPLM
EAVVNNHLEVARYMVQRGGCVYSKEEDGSTCLHHAAKIGNLEMVSLLLSTGQVDVNAQDS
GGWTPIIWAAEHKHIEVIRMLLTRGADVTLTDNVSERLVEEENICLHWASFTGSAAIAEV
LLNARCDLHAVNYHGDTPLHIAARESYHDCVLLFLSRGANPELRNKEGDTAWDLTPERSD
VWFALQLNRKLRLGVGNRAIRTEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISEN
CETSTMNIDRNITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFE
CNQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEYVGELISDAE
ADVREDDSYLFDLDNKDGEVYCIDARYYGNISRFINHLCDPNIIPVRVFMLHQDLRFPRI
AFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQCGSEKCKHSAEAIALEQSRLARLDPHP
ELLPELGSLPPVNT
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgcggggtctaccgagagggagggggttgatgcgggcccgggggaggggtcgtgcggcc
cctccgggcagccgaggccgcggaaggggggggccccatagaggaagaggtaggccccgg
agcctactctctcttcccagggcccaggcatcctggaccccccaactctctactgggctg
accagccctcctgtcccttgtctcccctcccagggggaggcccccgctgagatgggggcg
ctgctgctggagaaggaaaccagaggagccaccgagagagttcatggctctttgggggac
acacctcgtagtgaagaaaccctgcccaaggccacccccgactccctggagcctgctggc
ccctcatctccagcctctgtcactgtcactgttggcgatgagggggctgacacccctgta
ggggctacaccactcattggggatgaatctgagaatcttgagggagatggggacctccgt
gggggccggatcctgctgggccatgccacaaagtcattcccctcttcccccagcaagggg
ggttcctgtcctagccgggccaagatgtcaatgacaggggcgggaaaatcacctccatct
gtccagagtttggctatgaggctactgagtatgccaggagcccagggagctgcagcagca
gggtctgaaccccctccagccaccacgagcccagagggacagcccaaggtccaccgagcc
cgcaaaaccatgtccaaaccaggaaatggacagcccccggtccctgagaagcggccccct
gaagtacagcatttccgcatgagtgatgatgtccactcactgggaaaggtgacctcagat
ctggccaaaaggaggaagctgaactcaggaggtggcctgtcggaggagttaggttctgcc
cggcgttcaggagaagtgaccctgacgaaaggggaccccgggtccctggaggagtgggag
acggtggtgggtgatgacttcagtctctactatgattcctactctgtggatgagcgcgtg
gactccgacagcaagtctgaagttgaagctctaactgaacaactaagtgaagaggaggag
gaggaagaggaggaagaagaagaagaggaagaggaggaggaagaggaagaagaagaggaa
gatgaggagtcagggaatcagtcagataggagtggttccagtggccggcgcaaggccaag
aagaaatggcgaaaagacagcccatgggtgaagccatctcggaagcggcgcaagcgggag
cctccgcgggccaaggagccacgaggagtgaatggtgtgggctcctcaggccccagtgag
tacatggaggtccctctggggtccctggagctgcccagcgaggggaccctctcccccaac
cacgctggggtgtccaatgacacatcttcgctggagacagagcgagggtttgaggagttg
cccctgtgcagctgccgcatggaggcacccaagattgaccgcatcagcgagagggcgggg
cacaagtgcatggccaccgagagtgtggacggagagctgtcaggctgcaatgccgccatc
ctcaagcgggagaccatgaggccatccagccgtgtggccctgatggtgctctgtgagacc
caccgcgcccgcatggtcaaacaccactgctgcccgggctgcggctacttctgcacggcg
ggcaccttcctggagtgccaccctgacttccgtgtggcccaccgcttccacaaggcctgt
gtgtctcagctgaatgggatggtcttctgtccccactgtggggaggatgcttctgaagct
caagaggtgaccatcccccggggtgacggggtgaccccaccggccggcactgcagctcct
gcacccccacccctgtcccaggatgcccctgggagagcagacacttctcagcccagtgcc
cggatgcgagggcatggggaaccccggcgcccgccctgcgatcccctggctgacaccatc
gacagctcagggccctccctgaccctgcccaatgggggctgcctttcagccgtcgggctg
ccactggggccaggccgggaggccctggaaaaggccctggtcatccaggagtcagagagg
cggaagaagctccgtttccaccctcggcagttgtacctgtccgtgaagcagggcgagctg
cagaaggtgatcctgatgctgttggacaacctggaccccaacttccagagcgaccagcag
agcaagcgcacgcccctgcatgcagccgcccagaagggctccgtggagatctgccatgtg
ctgctgcaggctggagccaacataaatgcagtggacaaacagcagcggacgccactgatg
gaggccgtggtgaacaaccacctggaggtagcccgttacatggtgcagcgtggtggctgt
gtctatagcaaggaggaggacggttccacctgcctccaccacgcagccaaaatcgggaac
ttggagatggtcagcctgctgctgagcacaggacaggtggacgtcaacgcccaggacagt
ggggggtggacgcccatcatctgggctgcagagcacaagcacatcgaggtgatccgcatg
ctactgacgcggggcgccgacgtcaccctcactgacaacgtgagtgagcgtttggttgag
gaggagaacatctgcctgcactgggcctccttcacgggcagcgccgccatcgccgaagtc
cttctgaatgcgcgctgtgacctccatgctgtcaactaccatggggacacccccctgcac
atcgcagctcgggagagctaccatgactgcgtgctgttattcctgtcacgtggggccaac
cctgagctgcggaacaaagagggggacacagcatgggacctgactcccgagcgctccgac
gtgtggtttgcgcttcaactcaaccgcaaactccgacttggggtgggaaatcgggccatc
cgcacagagaagatcatctgccgggacgtggctcggggctatgagaacgtgcccattccc
tgtgtcaacggtgtggatggggagccctgccctgaggattacaagtacatctcggagaac
tgcgagacgtccaccatgaacatcgatcgcaacatcacccacctgcagcactgcacgtgt
gtggacgactgctctagctccaactgcctgtgcggccagctcagcatccggtgctggtat
gacaaggatgggcgattgctccaggaatttaacaagattgagcccccgctgattttcgag
tgtaaccaggcgtgctcatgctggagaaactgcaagaaccgggttgtacagagtggcatc
aaggtgcggctacagctctaccgaacagccaagatgggctggggggtccgcgccctacag
accatcccacaggggaccttcatctgcgagtatgtcggggagctgatctctgatgctgag
gctgatgtgagagaggatgattcttacctcttcgacttagacaacaaggatggagaggtg
tactgcattgatgcccgttactatggcaacatcagccgcttcatcaaccacctgtgtgac
cccaacatcattcccgtccgggtcttcatgctgcaccaagacctgcgatttccacgcatc
gccttcttcagttcccgagacatccggactggggaggagctagggtttgactatggcgac
cgcttctgggacatcaaaagcaaatatttcacctgccaatgtggctctgagaagtgcaag
cactcagccgaagccattgccctggagcagagccgtctggcccgcctggacccacaccct
gagctgctgcccgagctcggctccctgccgcctgtcaacacatga

DBGET integrated database retrieval system