KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139860Help
Entry
101139860         CDS       T02442                                 

Gene name
CAPN1
Definition
calpain-1 catalytic subunit isoform 1
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:ggo04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:ggo04210]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:ggo05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 714 aa AA seqDB search
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQMVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTAELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagatcatcacgccggtgtactgcaccggggtgtcagcccaagtgcagaag
cagcgggccagggagctgggcctgggccgccatgagaatgccatcaagtacctgggccag
gattatgagcagctgcgggtgcgatgcctgcagagtgggaccctcttccgtgatgaggcc
ttccccccggtgccccagagcctgggttacaaggacctgggtcccaattcctccaagacc
tatggcatcaagtggaagcgtcccacggagctgctgtcaaacccccagttcatcgtggat
ggagctacccgcacagacatctgccagggagcactgggggactgctggctcttggcggcc
atcgcctccctcactctcaacgacacccttctgcaccgagtggttccgcacggccagagc
ttccagaatggctatgccggcatcttccatttccagctgtggcaatttggggagtgggtg
gacgtggtcgtggatgacctgctgcccatcaaggacgggaagctagtgttcgtgcactct
gccgaaggcaacgagttctggagcgccctgcttgagaaggcctatgccaaggtaaatggc
agctacgaggccctgtcagggggcagcacctcagagggctttgaggacttcacaggcggg
gtcaccgagtggtacgagttgcgcaaggctcccagtgacctctaccagatcatcctcaag
gcgctggagcggggctccctgctgggctgctccatagacatctccagcgttctagacatg
gaggccatcaccttcaagaagctggtgaagggccacgcctattctgtgaccggggccaag
caggtgaactaccgaggccagatggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacgggagcctggagcgacagctcctcagagtggaacaacgtggacccatat
gaacgggaccagctccgggtcaagatggaggatggggagttctggatgtcattccgagac
ttcatgcgggagttcacccgcctggagatctgcaacctcacacccgacgccctcaagagc
cggaccatccgcaaatggaacaccacactctacgaaggcacctggcggcgggggagcacc
gcggggggctgccggaactacccagccaccttctgggtgaaccctcagttcaagatccgg
ctggatgagacggatgacccagacgactacggggaccgcgagtcaggctgcagcttcgtg
ctcgcccttatgcagaagcaccgtcgccgcgagcgccgctttggccgcgacatggagact
attggcttcgcggtctacgaggtccctccggagctggtgggccagccggccgtacacttg
aagcgtgacttcttcctggccaatgcgtctcgggcgcgctcagagcagttcatcaacctg
cgagaggtcagcacccgcttccgcctgccacccggggagtatgtggtggtgccctccacc
tttgagcccaacaaggagggcgacttcgtgctgcgcttcttctcggagaagagtgctggg
accgcggagctggatgaccagatccaggccaatctccctgatgagcaagtgctctcagaa
gaggagattgacgagaacttcaaggccctcttcaggcagctggcaggggaggacatggag
atcagcgtgaaggagttgcggacaatcctcaataggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctagagtcgtgccgcagcatggtgaacctcatggatcgtgat
ggcaatgggaagctgggtctggtggagttcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctacgagatg
cggatggccattgagtcggcaggcttcaagctcaacaagaagctgtacgagctcatcatc
acccgctactcggagcccgacctggcagtcgactttgacaatttcgtgtgctgcctggtg
cggctagagactatgttccgatttttcaaaactctggacacagatctggatggagtcgtg
acctttgacttgtttaagtggttgcagctgaccatgtttgcatga

DBGET integrated database retrieval system