KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139860Help
Entry
101139860         CDS       T02442                                 

Gene name
CAPN1
Definition
calpain-1 catalytic subunit isoform 1
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101139860 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101139860 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101139860 (CAPN1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     101139860 (CAPN1)
Peptidases [BR:ggo01002]
 Cysteine Peptidases
  Family C2: calpain family
   101139860 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 714 aa AA seqDB search
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQMVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTAELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagatcatcacgccggtgtactgcaccggggtgtcagcccaagtgcagaag
cagcgggccagggagctgggcctgggccgccatgagaatgccatcaagtacctgggccag
gattatgagcagctgcgggtgcgatgcctgcagagtgggaccctcttccgtgatgaggcc
ttccccccggtgccccagagcctgggttacaaggacctgggtcccaattcctccaagacc
tatggcatcaagtggaagcgtcccacggagctgctgtcaaacccccagttcatcgtggat
ggagctacccgcacagacatctgccagggagcactgggggactgctggctcttggcggcc
atcgcctccctcactctcaacgacacccttctgcaccgagtggttccgcacggccagagc
ttccagaatggctatgccggcatcttccatttccagctgtggcaatttggggagtgggtg
gacgtggtcgtggatgacctgctgcccatcaaggacgggaagctagtgttcgtgcactct
gccgaaggcaacgagttctggagcgccctgcttgagaaggcctatgccaaggtaaatggc
agctacgaggccctgtcagggggcagcacctcagagggctttgaggacttcacaggcggg
gtcaccgagtggtacgagttgcgcaaggctcccagtgacctctaccagatcatcctcaag
gcgctggagcggggctccctgctgggctgctccatagacatctccagcgttctagacatg
gaggccatcaccttcaagaagctggtgaagggccacgcctattctgtgaccggggccaag
caggtgaactaccgaggccagatggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacgggagcctggagcgacagctcctcagagtggaacaacgtggacccatat
gaacgggaccagctccgggtcaagatggaggatggggagttctggatgtcattccgagac
ttcatgcgggagttcacccgcctggagatctgcaacctcacacccgacgccctcaagagc
cggaccatccgcaaatggaacaccacactctacgaaggcacctggcggcgggggagcacc
gcggggggctgccggaactacccagccaccttctgggtgaaccctcagttcaagatccgg
ctggatgagacggatgacccagacgactacggggaccgcgagtcaggctgcagcttcgtg
ctcgcccttatgcagaagcaccgtcgccgcgagcgccgctttggccgcgacatggagact
attggcttcgcggtctacgaggtccctccggagctggtgggccagccggccgtacacttg
aagcgtgacttcttcctggccaatgcgtctcgggcgcgctcagagcagttcatcaacctg
cgagaggtcagcacccgcttccgcctgccacccggggagtatgtggtggtgccctccacc
tttgagcccaacaaggagggcgacttcgtgctgcgcttcttctcggagaagagtgctggg
accgcggagctggatgaccagatccaggccaatctccctgatgagcaagtgctctcagaa
gaggagattgacgagaacttcaaggccctcttcaggcagctggcaggggaggacatggag
atcagcgtgaaggagttgcggacaatcctcaataggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctagagtcgtgccgcagcatggtgaacctcatggatcgtgat
ggcaatgggaagctgggtctggtggagttcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctacgagatg
cggatggccattgagtcggcaggcttcaagctcaacaagaagctgtacgagctcatcatc
acccgctactcggagcccgacctggcagtcgactttgacaatttcgtgtgctgcctggtg
cggctagagactatgttccgatttttcaaaactctggacacagatctggatggagtcgtg
acctttgacttgtttaagtggttgcagctgaccatgtttgcatga

DBGET integrated database retrieval system